A kind of polypeptide fragment d and its application
A drug and inflammatory bowel disease technology, applied in the field of polypeptide fragment D and its application, can solve the problems of reducing the colonic histopathological score of IBD mice, easy to produce immunogenicity, and difficult to become a drug, so as to reduce the colonic histopathological Scoring, improvement of colonic pathological morphology, effect of small molecular weight
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] Example 1: Experiment on the effect of MP-D intervention on DSS-induced inflammatory bowel disease in mice
[0030] The sequence of the polypeptide fragment D (MP-D) used in this example is the amino acid sequence shown in SEQ ID No. 1, when the 9th amino acid Xaa is Gln, the 20th amino acid Xaa is Arg, and the 25th amino acid Xaa is Asn The sequence of THTVGSYFQVQNGYVGAFSRALGNNEYAMNS.
[0031] 1. Experimental method
[0032] 1.1 Establishment of a mouse model of acute inflammatory bowel disease
[0033] When a certain concentration of DSS solution is administered to mice, an acute inflammatory bowel disease model characterized by diarrhea, blood in the stool, ulcers, and granulocyte infiltration can be induced. The experimental grouping followed the principle of randomization, and the mice were randomly divided into stratified groups according to the weight of the mice. Forty healthy male C57BL6 mice were divided into four groups of 10 mice each:
[0034] Blank con...
Embodiment 2
[0060] The reagents, materials, equipment, and experimental methods used in this example are all the same as those in Example 1, except that the sequence of the polypeptide fragment D (MP-D) used in this example is the amino acid shown in SEQ ID No.1 The 9th amino acid Xaa of the sequence is Tyr, the 20th amino acid Xaa is Glu, and the 25th amino acid Xaa is the sequence when Thr is THTVGSYFYVQNGYVGAFSEALGNTEYAMNS.
Embodiment 3
[0062] The reagents, materials, equipment, and experimental methods used in this example are all the same as those in Example 1, except that the sequence of the polypeptide fragment D (MP-D) used in this example is the amino acid shown in SEQ ID No.1 The 9th amino acid Xaa of the sequence is Gly, the 20th amino acid Xaa is Ser, and the 25th amino acid Xaa is Pro, namely THTVGSYFGVQNGYVGAFSSALGNPEYAMNS.
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com