Polypeptide fragment C and application thereof
A technology of polypeptide fragments and amino acids, applied in the field of biomedicine, can solve problems such as easy to produce immunogenicity, difficult to make drugs, reduce disease activity index and colon histopathological score in IBD mice
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0030] Example 1: Experiment of the effect of MP-C intervention on DSS-induced inflammatory bowel disease in mice
[0031] The sequence of the polypeptide fragment C (MP-C) used in this example is that the 9th amino acid Xaa of the amino acid sequence shown in SEQ ID No. 1 is Val, the 20th amino acid Xaa is Tyr, and the 30th amino acid Xaa is Ser. The sequence when the 42nd amino acid Xaa is Arg, namely THTVGSYFVVQNGYVGAFSYALGNSEYAMSSPLGSLDGRTTRYNLL.
[0032] 1. Experimental method
[0033] 1.1 Establishment of mouse model of acute inflammatory bowel disease
[0034] When a certain concentration of DSS solution is administered to mice, an acute inflammatory bowel disease model characterized by diarrhea, blood in the stool, ulcers, and granulocyte infiltration can be induced. The experimental grouping followed the principle of randomness, and stratified random grouping was carried out according to the weight of the mice. Divide 40 healthy male C57BL6 mice into four groups of...
Embodiment 2
[0066] The reagents, materials, equipment, and experimental methods used in this example are the same as in Example 1, the only difference being that the sequence of the polypeptide fragment C (MP-C) used in this example is the amino acid shown in SEQ ID No.1 The 9th amino acid Xaa of the sequence is Tyr, the 20th amino acid Xaa is Ser, the 30th amino acid Xaa is Thr, and the 42nd amino acid Xaa is Gly, that is THTVGSYFYVQNGYVGAFSSALGNSEYAMTSPLGSLDGRTTGYNLL.
Embodiment 3
[0068] The reagents, materials, equipment, and experimental methods used in this example are the same as in Example 1, the only difference being that the sequence of the polypeptide fragment C (MP-C) used in this example is the amino acid shown in SEQ ID No.1 The 9th amino acid Xaa of the sequence is Gln, the 20th amino acid Xaa is Glu, the 30th amino acid Xaa is Pro, and the 42nd amino acid Xaa is Met, that is THTVGSYFQVQNGYVGAFSEALGNSEYAMPSPLGSLDGRTTMYNLL.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 



