Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A kind of polypeptide fragment b and its application

A technology of drugs and pharmaceutical preparations, applied in the field of polypeptide fragment B and its application, can solve the problems of easy to produce immunogenicity, difficult to make drugs, etc., to improve and intervene in the occurrence of inflammatory bowel disease in mice, small molecular weight, and improve colon pathology Sexual Form Effects

Active Publication Date: 2022-07-26
SHANGHAI LONGXIN BIOMEDICAL TECH CO LTD
View PDF6 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] In order to solve the shortcomings of MIMP, which has an improving effect on inflammatory bowel disease in the prior art, which is prone to immunogenicity and difficult to be drugged, the purpose of the present invention is to provide a polypeptide fragment B, a pharmaceutical preparation and its application. Peptide Fragment B Can Significantly Improve Pathological Colon Shortening and Colon Histopathological Score in IBD Mouse Model

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of polypeptide fragment b and its application
  • A kind of polypeptide fragment b and its application
  • A kind of polypeptide fragment b and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0027] Example 1: Experiment on the effect of MP-B intervention on DSS-induced inflammatory bowel disease in mice

[0028] The sequence of the polypeptide fragment B (MP-B) used in this example is the amino acid sequence shown in SEQ ID No. 1. When the 10th amino acid Xaa is Glu, the 16th amino acid Xaa is Gly, and the 25th amino acid Xaa is Met The sequence, namely SPLGSLDGRETMYNLGGVKYLFARMDQLKKQ.

[0029] 1. Experimental method

[0030] 1.1 Establishment of a mouse model of acute inflammatory bowel disease

[0031] When a certain concentration of DSS solution is administered to mice, an acute inflammatory bowel disease model characterized by diarrhea, blood in the stool, ulcers, and granulocyte infiltration can be induced. The experimental grouping followed the principle of randomization, and the mice were randomly divided into stratified groups according to the weight of the mice. Forty healthy male C57BL6 mice were divided into four groups of 10 mice each:

[0032] Bla...

Embodiment 2

[0053] The reagents, materials, equipment, and experimental methods used in this example are the same as those in Example 1, except that the sequence of the polypeptide fragment B (MP-B) used in this example is the amino acid shown in SEQ ID No.1 The 10th amino acid Xaa of the sequence is Arg, the 16th amino acid Xaa is Asn, and the 25th amino acid Xaa is the sequence when Glu is SPLGSLDGRRTMYNLNGVKYLFAREDQLKKQ.

Embodiment 3

[0055] The reagents, materials, equipment, and experimental methods used in this example are the same as those in Example 1, except that the sequence of the polypeptide fragment B (MP-B) used in this example is the amino acid shown in SEQ ID No.1 The 10th amino acid Xaa of the sequence is Thr, the 16th amino acid Xaa is Val, and the 25th amino acid Xaa is Ser, that is, SPLGSLDGRTTMYNLVGVKYLFARSDQLKKQ.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of biomedicine, and in particular relates to a polypeptide fragment B and an application thereof. The polypeptide fragment B has the amino acid sequence shown in SEQ ID No. 1, wherein the tenth amino acid Xaa is Arg, Phe, Glu, Thr or absent, amino acid Xaa at position 16 is Asn, Val, Leu, Gly or absent, amino acid Xaa at position 25 is Ser, Glu, Met, Arg or absent. MP‑B significantly improved the colonic pathological morphology of the IBD mouse model, decreased the colonic histopathological score and the expression of colonic interferon‑γ, and had the ability to interfere with the occurrence of inflammatory bowel disease in mice.

Description

technical field [0001] The invention belongs to the technical field of biomedicine, and specifically relates to a polypeptide fragment B and its application. Background technique [0002] Inflammatory bowel disease (IBD) is an idiopathic chronic intestinal inflammatory disease. The lesions are mainly located in the colorectal segment, and involve the mucosa and muscularis mucosae. The severe ones include liver and gallbladder, muscle skin and coagulation. In terms of complications, 20-30% of patients with recurrent disease may be transformed into colorectal cancer, which is a very serious intestinal inflammatory disease, which can be divided into ulcerative colitis (UC) and Crohn's disease. (Crohn's disease, CD) two categories. At present, it is believed that IBD is an intestinal inflammatory reaction caused by abnormal innate immunity and acquired immunity of the intestinal mucosa under the interaction of multiple factors such as environment, heredity, infection and immuni...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/335A61K38/16A61P1/00A23L33/18
CPCC07K14/335A61P1/00A23L33/18A61K38/00A23V2002/00A23V2200/32A23V2250/55C12R2001/25A23L33/40C07K14/47
Inventor 张彩华常英
Owner SHANGHAI LONGXIN BIOMEDICAL TECH CO LTD
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com