A kind of polypeptide fragment b and its application
A technology of drugs and pharmaceutical preparations, applied in the field of polypeptide fragment B and its application, can solve the problems of easy to produce immunogenicity, difficult to make drugs, etc., to improve and intervene in the occurrence of inflammatory bowel disease in mice, small molecular weight, and improve colon pathology Sexual Form Effects
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0027] Example 1: Experiment on the effect of MP-B intervention on DSS-induced inflammatory bowel disease in mice
[0028] The sequence of the polypeptide fragment B (MP-B) used in this example is the amino acid sequence shown in SEQ ID No. 1. When the 10th amino acid Xaa is Glu, the 16th amino acid Xaa is Gly, and the 25th amino acid Xaa is Met The sequence, namely SPLGSLDGRETMYNLGGVKYLFARMDQLKKQ.
[0029] 1. Experimental method
[0030] 1.1 Establishment of a mouse model of acute inflammatory bowel disease
[0031] When a certain concentration of DSS solution is administered to mice, an acute inflammatory bowel disease model characterized by diarrhea, blood in the stool, ulcers, and granulocyte infiltration can be induced. The experimental grouping followed the principle of randomization, and the mice were randomly divided into stratified groups according to the weight of the mice. Forty healthy male C57BL6 mice were divided into four groups of 10 mice each:
[0032] Bla...
Embodiment 2
[0053] The reagents, materials, equipment, and experimental methods used in this example are the same as those in Example 1, except that the sequence of the polypeptide fragment B (MP-B) used in this example is the amino acid shown in SEQ ID No.1 The 10th amino acid Xaa of the sequence is Arg, the 16th amino acid Xaa is Asn, and the 25th amino acid Xaa is the sequence when Glu is SPLGSLDGRRTMYNLNGVKYLFAREDQLKKQ.
Embodiment 3
[0055] The reagents, materials, equipment, and experimental methods used in this example are the same as those in Example 1, except that the sequence of the polypeptide fragment B (MP-B) used in this example is the amino acid shown in SEQ ID No.1 The 10th amino acid Xaa of the sequence is Thr, the 16th amino acid Xaa is Val, and the 25th amino acid Xaa is Ser, that is, SPLGSLDGRTTMYNLVGVKYLFARSDQLKKQ.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


