Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Long-acting oxyntomodulin (oxm) hybrid peptide and its preparation method and application

A compound and amino acid technology, applied in the field of long-acting oxyntomodulin hybrid peptide, can solve the problems of weak hypoglycemic activity and short half-life

Active Publication Date: 2021-08-06
CHINA PHARM UNIV
View PDF10 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Compared with pure GLP-1R agonists, OXM has a better effect in intervening body weight, regulating lipid metabolism, and improving glucose tolerance, but its hypoglycemic activity is relatively weak and its half-life is short

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Long-acting oxyntomodulin (oxm) hybrid peptide and its preparation method and application
  • Long-acting oxyntomodulin (oxm) hybrid peptide and its preparation method and application
  • Long-acting oxyntomodulin (oxm) hybrid peptide and its preparation method and application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0083]

[0084] solid phase synthesis

[0085] 1, the synthesis of formula I

[0086]Weigh 100mg of 2-CTC resin (degree of substitution: 0.8mmol / g), swell with DCM for 30min, then swell with 10mL of NMP for 30min, rinse with NMP and 7mL of DCM respectively. Fmoc-AEEA (61.6 mg, 0.16 mmol), HBTU (60.6 mg, 0.16 mmol), DIEA (55.6 μL, 0.32 mmol), HOBt (21.6 mg, 0.16 mmol) were dissolved in NMP 10 mL, and this solution was added to the resin After reacting for 2 hours, the reaction solution was filtered off, and 10 mL of DCM:methanol:DIEA 5:4:1 solution was added to the resin to block the reaction for 1 hour, the reaction solution was filtered off, and the resin was washed 3 times with 7 mL each of DCM and NMP.

[0087] Add 25% piperidine / NMP (V / V) solution containing 0.1M HOBt to the resin to remove Fmoc, and wash with NMP after the reaction. In the same way, Fmoc-AEEA was coupled again. After the reaction, the resin was washed 3 times with 7 mL each of DCM and NMP. Add 25% p...

Embodiment 2

[0103]

[0104] The synthesis method was the same as in Example 1, and the collected solution was lyophilized to obtain 26.4 mg of the pure product. The theoretical relative molecular mass is 5010.6. ESI-MS m / z: Calcd.[M+3H] 3+ 1671.2, [M+4H] 4+ 1253.7; Found[M+3H] 3+ 1671.8, [M+4H] 4+ 1253.1.

Embodiment 3

[0106]

[0107] The synthesis method was the same as in Example 1, and the collected solution was lyophilized to obtain 24.2 mg of the pure product. The theoretical relative molecular mass is 4969.5. ESI-MS m / z: Calcd.[M+3H] 3+ 1657.5, [M+4H] 4+ 1243.4; Found[M+3H] 3+ 1657.3, [M+4H] 4+ 1243.7.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention relates to a kind of long-acting oxyntomodulin (OXM) hybrid peptide and its application and synthesis method. By modifying OXM, hybridizing with the peptide sequence of Exenatide, and conjugating fatty acid chains, the OXM hybrid peptide with longer pharmacological action time and better weight loss effect is obtained. The synthesis of the target polypeptide is quickly realized through the solid-phase synthesis method of the orthogonal protection strategy, and the crude product is purified and freeze-dried to obtain the target compound.

Description

technical field [0001] The invention relates to the field of medicinal chemistry, in particular to long-acting oxyntomodulin (OXM) hybrid peptide and application thereof. Background technique [0002] The cause of metabolic syndrome is abnormal metabolism of various substances such as protein, fat and carbohydrates. Overnutrition and reduced physical activity can lead to obesity and obesity-related diseases such as diabetes. In recent years, the incidence of type 2 diabetes and dyslipidemia has been increasing day by day. [0003] Oxyntomodulin (OXM) is a polypeptide composed of 37 amino acids secreted by small intestinal L cells, including the entire 29 amino acid sequence of glucagon and the 8 amino acid part of the C-terminal extension, which is similar to glucagon Peptide-1 (GLP-1) has 50% homology, and the peptide sequence is: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA. OXM can simultaneously activate glucagon-like peptide-1 receptor (GLP-1R) and glucagon receptor (GCGR),...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K19/00A61K38/22A61K38/26A61P3/10A61P3/04A61P3/06A61P1/16
CPCA61K38/00A61P1/16A61P3/04A61P3/06A61P3/10C07K14/57563C07K14/605C07K2319/00A61K47/542
Inventor 钱海黄文龙蔡星光刘春霞李久辉戴雨轩李承业
Owner CHINA PHARM UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com