Tumor associated antigen XAGE-1b short peptide and application thereof

A technology of short peptides and antigenic components, applied in the direction of tumor-specific antigens, tumor rejection antigen precursors, anti-tumor drugs, etc., can solve the problems of poor specificity of short peptides and unsatisfactory results

Active Publication Date: 2017-01-04
广州美萨生物科技有限公司
View PDF5 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In the technical scheme disclosed by CN102428102A, an attempt is made to intercept a part of the XAGE-1b antigen to induce humoral immunity or cellular immunity to the tumor, but the result is not satisfactory, and the length of the polypeptide is still not shorter than 16AA
[0013] Short peptides may also have the problem of poor specificity. How to obtain short peptides with good specificity and good immunogenicity is a very challenging task

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Tumor associated antigen XAGE-1b short peptide and application thereof
  • Tumor associated antigen XAGE-1b short peptide and application thereof
  • Tumor associated antigen XAGE-1b short peptide and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0027] The tumor antigen is XAGE-1b antigen. The XAGE-1b gene is located on the X chromosome (Xp11.21-Xp11.22), with a full length of 622bp, encoding a protein precursor composed of 81 amino acids. The amino acid sequence is as follows (from GenBank: NM_001097594.2):

[0028]MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV (SEQ ID NO: 1)

[0029] The technical solution of the present invention will be further described below in combination with experiments.

[0030] Expression of XAGE-1b in non-small cell lung cancer

[0031] XAGE-1 is an important member of the CTA family. In addition to being widely expressed in non-small cell lung cancer, it is also expressed in a variety of malignant tumors. It is extremely important to establish XAGE-1b antigen peptide-specific CTL clones. In the previous study, the inventors randomly selected surgically resected lung cancer specimens (all confirmed by pathological examination and obtained the consent of...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses a tumor associated antigen XAGE-1b short peptide and application thereof. The sequence of the short peptide is one of SEQ ID NO:2-SEQ ID NO:15. CTL established by induction of XAGE-1b antigen peptide cannot generate an immunologic response to testis cells and only kills tumor cells. CTL clone obtained by induction has a favorable specific tumor cell killing effect; meanwhile, during a CTL establishment process, the inventor discovers that the screened XAGE-1b antigen peptide has appropriate appetency with HLA on DC cells and is capable of effectively stimulating and inducing production of specific CTLs, which indicates that the XAGE-1b antigen peptide has favorable polypeptide vaccine and DC vaccine potentials. By virtue of cloning the specific TCR genes of the XAGE-1b antigen peptide, a virus carrier is established, peripheral circulation CD8+T cells are transduced, TCR gene modified T cell (TCR-T) clone is obtained and also has a similar specific tumor cell killing effect with the parent-generation CTL, which indicates that the TCR gene modified T cell clone has favorable clinical conversion and practical application prospects.

Description

technical field [0001] The invention relates to tumor-associated antigen peptides and applications thereof, in particular to tumor-associated antigen XAGE-1b short peptides and applications thereof. Background technique [0002] As we all know, T cell adoptive therapy for tumors is currently the most eye-catching technology, especially the application of receptor-engineered T cells is becoming an exciting cancer treatment method, and it also has broad application prospects for viral infections and autoimmune diseases. [0003] The human immune surveillance system plays an important role in the process of resisting tumor growth. The immune surveillance system achieves the purpose of inhibiting tumor growth by coordinating various types of immune cells, among which cytotoxic T cells (cytotoxic Tlymphocytes, CTLs) play an extremely important role and are the most important. Key killer effector cells. tumor antigen-specific CD8 + T cells can specifically recognize and directly...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/47C12N5/0783A61K39/00A61P35/00G01N33/68G01N33/574
CPCA61K39/0011A61K2039/5154A61K2039/572C07K14/4748C12N5/0638C12N2501/998C12N2502/1121G01N33/57423G01N33/68G01N2333/47
Inventor 安军
Owner 广州美萨生物科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products