Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Tumor-associated antigen xage-1b short peptide and its application

A technology of xage-1b, 1.xage-1b, applied in tumor-associated antigen XAGE-1b short peptide and its application field, can solve the problems of poor specificity of short peptide and unsatisfactory results

Active Publication Date: 2018-08-21
安军 +1
View PDF6 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In the technical scheme disclosed by CN102428102A, an attempt is made to intercept a part of the XAGE-1b antigen to induce humoral immunity or cellular immunity to the tumor, but the result is not satisfactory, and the length of the polypeptide is still not shorter than 16AA
[0013] Short peptides may also have the problem of poor specificity. How to obtain short peptides with good specificity and good immunogenicity is a very challenging task

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Tumor-associated antigen xage-1b short peptide and its application
  • Tumor-associated antigen xage-1b short peptide and its application
  • Tumor-associated antigen xage-1b short peptide and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0029] The tumor antigen is XAGE-1b antigen. The XAGE-1b gene is located on the X chromosome (Xp11.21-Xp11.22), with a full length of 622bp, encoding a protein precursor composed of 81 amino acids. The amino acid sequence is as follows (from GenBank: NM_001097594.2):

[0030] MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV (SEQ ID NO: 1)

[0031] The technical solution of the present invention will be further described below in combination with experiments.

[0032] Expression of XAGE-1b in non-small cell lung cancer

[0033] XAGE-1 is an important member of the CTA family. In addition to being widely expressed in non-small cell lung cancer, it is also expressed in a variety of malignant tumors. It is extremely important to establish XAGE-1b antigen peptide-specific CTL clones. In the previous study, the inventors randomly selected surgically resected lung cancer specimens (all confirmed by pathological examination and obtained the consent o...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a tumor-associated antigen XAGE-1b short-peptide and application thereof. The sequences of the short-peptide is one of the SEQ ID NO:2-SEQ ID NO:15. The CTL induced by the XAGE-1b antigen peptide does not produce an immune response to testicular cells, and only kills tumor cells. The obtained CTL clone has a good specific killing effect on tumor cells. The selected XAGE-1b antigen peptide has comparable affinity to HLA on DC cells and can effectively stimulate and induce specific CTLs, indicating that the selected XAGE-1b antigen peptide has good potential of polypeptide vaccine and DC vaccine. By cloning XAGE-1b antigen peptide specific TCR gene, constructing viral vector, transducing peripheral circulation CD8+T cells, TCR gene modified T cells (TCR-T) clone is obtained, and also has specific killing effect on tumor cells which is similar to parental CTL, suggesting that the XAGE-1b short-peptide has good clinical application and transformation prospect.

Description

technical field [0001] The invention relates to tumor-associated antigen peptides and applications thereof, in particular to tumor-associated antigen XAGE-1b short peptides and applications thereof. Background technique [0002] As we all know, T cell adoptive therapy for tumors is currently the most eye-catching technology, especially the application of receptor-engineered T cells is becoming an exciting cancer treatment method, and it also has broad application prospects for viral infections and autoimmune diseases. [0003] The human immune surveillance system plays an important role in the process of resisting tumor growth. The immune surveillance system achieves the purpose of inhibiting tumor growth by coordinating various types of immune cells, among which cytotoxic T cells (cytotoxic Tlymphocytes, CTLs) play an extremely important role and are the most important. Key killer effector cells. tumor antigen-specific CD8 + T cells can specifically recognize and directly...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/47C12N5/0783C12N5/0784A61K39/00A61P35/00G01N33/68G01N33/574
CPCA61K39/00C07K14/4748C12N5/0636C12N2502/1121G01N33/57423G01N33/6854
Inventor 安军
Owner 安军
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products