Tumor-associated antigen xage-1b short peptide and its application
A technology of xage-1b, 1.xage-1b, applied in tumor-associated antigen XAGE-1b short peptide and its application field, can solve the problems of poor specificity of short peptide and unsatisfactory results
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0029] The tumor antigen is XAGE-1b antigen. The XAGE-1b gene is located on the X chromosome (Xp11.21-Xp11.22), with a full length of 622bp, encoding a protein precursor composed of 81 amino acids. The amino acid sequence is as follows (from GenBank: NM_001097594.2):
[0030] MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV (SEQ ID NO: 1)
[0031] The technical solution of the present invention will be further described below in combination with experiments.
[0032] Expression of XAGE-1b in non-small cell lung cancer
[0033] XAGE-1 is an important member of the CTA family. In addition to being widely expressed in non-small cell lung cancer, it is also expressed in a variety of malignant tumors. It is extremely important to establish XAGE-1b antigen peptide-specific CTL clones. In the previous study, the inventors randomly selected surgically resected lung cancer specimens (all confirmed by pathological examination and obtained the consent o...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


