Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

171 results about "Platelet aggregation inhibitor" patented technology

Drugs or agents which antagonize or impair any mechanism leading to blood platelet aggregation, whether during the phases of activation and shape change or following the dense-granule release reaction and stimulation of the prostaglandin-thromboxane system.

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Optimized stent jacket

ActiveUS20100241214A1Reducing platelet aggregationReduce aggregationStentsSurgeryFiberAdditive ingredient
A method of stenting, comprises: implanting a stent assembly in a vessel of a subject, the stent assembly, including: a stent jacket, comprising an expansible mesh structure, formed of fibers of a diameter between about 7 micrometers and about 18 micrometers, the diameter having a property of forming a substantially stable layer of endothelial cells, covering the fibers, thus reducing platelet aggregation, and an expansible stent, operatively associated with the stent jacket. The method further comprises administering to the subject an active pharmaceutical ingredient (API) comprising a platelet aggregation reducer for a shortened time period, not exceeding six months, the shortened time period being a consequence of the property. In accordance with some embodiments, the administration of a platelet aggregation.
Owner:INSPIRE M D LTD

Platelet aggregation inducing substance

A platelet aggregation inducing substance containing as an active ingredient a polypeptide having a peptide fragment represented by formula (1) (component A):-(Pro-X-Gly)n-   (1)wherein X represents Pro or Hyp; and n represents an integer of from 20 to 5,000.
Owner:JNC CORP

Quinolone derivative or salt thereof

InactiveUS20060148806A1High pharmacological effectImprove balanceBiocideSurgical drugsQuinoloneMedicine
A platelet aggregation inhibitor comprising a quinolone derivative or a pharmaceutically acceptable salt thereof as an active ingredient, and a novel quinolone derivative or a pharmaceutically acceptable salt thereof useful as a platelet aggregation inhibitor.
Owner:ASTELLAS PHARMA INC

Pyrazole derivative

InactiveUS20060128685A1Inhibit thrombogenesisInhibit aggregationBiocideOrganic chemistrySolventIschemic disease
The present invention is directed to a strong platelet aggregation-inhibiting agent which does not inhibit COX-1 or COX-2. The present invention provides compounds represented by formula (I) or formula (II), salts of the compounds, and solvates of the compounds or the salts. Also provided are medicaments containing any of the compounds, salts, or solvates and preventive and / or therapeutic agents for ischemic diseases, containing any of the compounds, salts, or the solvates.
Owner:DAIICHI PHARMA CO LTD

Inhibitors of thrombin induced platelet aggregation

The present invention describes a therapeutic method useful for treating or preventing a condition of platelet aggregation in a subject including administering a pharmaceutically effective amount of a compound or composition that inhibits JAK-3 and / or tyrosine phosphorylation of STAT-3 and inhibits thrombin induced platelet aggregation. The condition of platelet aggregation includes hematopoietic and cerbrovascular diseases.
Owner:PARKER HUGHES INST

Methods of measuring inhibition of platelet aggregation by thrombin receptor antagonists

InactiveUS20080299587A1Microbiological testing/measurementBiological testingThrombin receptor antagonistNK1 receptor antagonist
A method is provided for measuring inhibition of platelet aggregation by a thrombin receptor antagonist. First, a blood sample is obtained from a patient treated with a thrombin receptor antagonist. The blood sample is mixed in combination with particles including an immobilized GPIIb / IIIa receptor ligand and a thrombin receptor activator. The combination is then incubated under conditions suitable for agglutinating the particles, and platelet-mediated agglutination is assessed in the mixture. The absence of agglutination indicates that the patient has reduced ability to form platelet thrombi in response to the thrombin receptor antagonist treatment. Also provided is a kit for measuring inhibition of platelet aggregation by a thrombin receptor antagonist that includes a GPIIb / IIIa receptor ligand immobilized on a particle, a thrombin receptor activator, an anticoagulant, and a buffer to maintain the anticoagulated blood in a condition suitable for platelet aggregation.
Owner:ACCUMETRICS INC

Indenone derivative and applications thereof as developing agent and aggregation inhibitor of amyloid protein deposit and neurofibrillary tangle

The invention relates to a compound in a general formula (1), applications of pharmaceutically acceptable salt, esters, amides or predrug of the compound as a developing agent and an aggregation inhibitor of amyloid protein deposit and neurofibrillary tangle, a preparation method of a labeled compound used for development, and a method for conveying the compound to the amyloid protein deposit and the neurofibrillary tangle. When the compound is taken as the developing agent used for detecting in vivo or tissue amyloid protein deposit and neurofibrillary tangle, appropriate radioactive isotope or a contrast agent applicable to magnetic resonance detection needs to be used for labeling the compound. The compound is especially used for the diagnosis and treatment of patients with amyloid protein deposit and neurofibrillary tangle diseases including Alzheimer disease.
Owner:UNIV OF SCI & TECH OF CHINA

Quinolone derivative or salt thereof

InactiveUS7488739B2Improve securitySmall adverse bleeding effectBiocideSurgical drugsQuinoloneMedicine
A platelet aggregation inhibitor comprising a quinolone derivative or a pharmaceutically acceptable salt thereof as an active ingredient, and a novel quinolone derivative or a pharmaceutically acceptable salt thereof useful as a platelet aggregation inhibitor.
Owner:ASTELLAS PHARMA INC

Injectio for inhibiting platelet aggregation and its preparation process

The invention relates to an injection for inhibiting platelet aggregation and its preparation process, wherein the injection comprises Tirofiban Hydrochloride, water and sodium chloride, and is prepared through the steps of, weighing sodium chloride by formula amount, charging into 5000ml water, stirring to complete dissolving, weighing activated charcoal 0.3% of the solution amount, and homogenizing, heating and boiling for 15 minutes, cooling down, filtering the activated charcoal, accurately weighing Tirofiban Hydrochloride by formula amount, dissolving completely with water, charging into the sodium chloride solution, and watering to near total amount, adjusting the pH to 5.5-6.5 with hydrochloric acid, watering to specified amount, filtering with 0.45 um microporous filtration film, split charging into bottle, sterilizing 35 minutes through hot compression at 115 deg. C.
Owner:GRAND PHARM (CHINA) CO LTD

Prostacyclin derivatives

This invention relates to novel prostacyclin derivatives, their acceptable acid addition salts, solvates, hydrates and polymorphs thereof. The invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions beneficially treated by prostacyclin, and in particular those diseases and conditions beneficially treated by dilators of systemic and pulmonary arterial vascular beds or by platelet aggregation inhibitors.
Owner:CONCERT PHARMA INC

Nanoparticulate and Controlled Release Compositions Comprising a Platelet Aggregation Inhibitor

InactiveUS20090297596A1Reduces and eliminates developmentQuick releasePowder deliveryBiocideControlled releaseNanoparticle
The present invention provides a composition comprising a platelet aggregation inhibitor, for example, cilostazol, or a salt or derivative thereof, useful in the treatment and prevention of ischemic symptoms. The invention provides a composition which comprises nanoparticulate particles comprising the platelet aggregation inhibitor and at least one surface stabilizer. The nanoparticulate particles have an effective average particle size of less than about 2000 nm. The invention provides also a composition that delivers a platelet aggregation inhibitor, or nanoparticles comprising the same, in a pulsatile or continuous manner.
Owner:ELAN PHRMA INT LTD

Nucleic acid modulators of glycoprotein vi

The present invention relates, in general, to a pharmacologic system to modulate the biology of platelets based upon a nucleic acid ligand that can interact with and modulate the activity of platelet glycoprotein GPVI to regulate platelet function. These nucleic acid ligands are also actively reversible using a modulator that inhibits the activity of the nucleic acid ligand to neutralize this pharmacologic effect and thereby restore GPVI function, including collagen binding, platelet adhesion, collagen-induced platelet activation, and collagen-induced platelet aggregation. The invention further relates to compositions comprising the nucleic acid ligand, the ligand and a modulator, methods to generate the nucleic acid ligand and its modulator, as well as methods of using these agents and compositions in medical therapeutic and diagnostic procedures.
Owner:TOBIRA THERAPEUTICS

Combination therapy for inhibition of platelet aggregation

The invention features methods for preventing platelet activation and aggregation and for treating individuals suffering from conditions or undergoing procedures that may result in unwanted platelet aggregation. The methods are based on the intravenous, subcutaneous, or transdermal administration of a platelet activation or aggregation inhibitor, e.g., xemilofiban, followed by oral administration of the same or a different platelet activation or aggregation inhibitor. The treatment may commence prior to a medical or surgical procedure or after the outbreak of an adverse medical condition, either of which results in the activation of platelets that may lead to thrombus formation, and may continue thereafter.
Owner:PORTER R STEPHEN +3

Quinolone derivative or pharmaceutically acceptable salt thereof

[Problem] To provide a compound having excellent platelet aggregation inhibitory activity.[Means for Resolution] It was found that quinolone derivatives characterized in that these have lower alkyl, cycloalkyl or the like at the 1-position; —N(R0)C(O)-lower alkylene-CO2R0, lower alkylene-CO2R0, lower alkenylene-CO2R0, —O-lower alkylene-CO2R0, —O-(lower alkylene which may be substituted with —CO2R0)-aryl or —O-lower alkenylene-CO2R0 (wherein R0 is H or lower alkyl) at the 3-position; halogen at the 6-position; and amino group substituted with a substituent group having a ring structure at the 7-position, respectively, or pharmaceutically acceptable salts thereof, has excellent P2Y12 inhibitory activity. In addition, it was confirmed that these quinolone derivatives also have excellent platelet aggregation inhibitory activity. Based on the above, these quinolone derivatives or pharmaceutically acceptable salts thereof are useful as platelet aggregation inhibitors.
Owner:ASTELLAS PHARMA INC

Applications of demethoxyviridin in preparing Amyloid-beta aggregation inhibitor

InactiveCN103316020AAggregation inhibiting activityOrganic active ingredientsNervous disorderMedicineAmyloid beta
The invention belongs to the field of microbial medicine, and discloses applications of demethoxyviridin, a steroid compound, in preparing an Amyloid-beta aggregation inhibitor. The Amyloid-beta aggregation inhibitor is used for preparing medicament for treating Alzheimer's disease. The demethoxyviridin is obtained by fermenting and separating Nodulisporium sp. 65-12-7-1.
Owner:JINAN UNIVERSITY

Bicyclic heterocyclic compound

InactiveUS20100113391A1Excellent P2Y1 inhibitory actionBiocideAntipyreticQuinoloneQuinazoline
[Problem]Provided is a compound, which exhibits a P2Y12 inhibitory action and is useful as a medical drug, particularly, as a platelet aggregation inhibitor.[Means for Solution]The inventors have eagerly investigated P2Y12 inhibitors. As a result, the inventors have found that a bicyclic heterocyclic compound such as quinazolinedione, isoquinolone, and the like having an amino group substituted with lower alkyl, cycloalkyl, or lower alkylene-cycloalkyl at the specific position exhibits an excellent platelet aggregation inhibitory action, thereby completing the present invention. Since the compound of the invention exhibits excellent P2Y12 inhibitory action and platelet aggregation inhibitory action, it is useful as a platelet aggregation inhibitor.
Owner:ASTELLAS PHARMA INC

Small peptide capable of resisting thrombosis and platelet aggregation

The invention discloses a small peptide capable of resisting thrombosis and platelet aggregation, and the sequence of the small peptide is X-Arg-Y-X-Lys, wherein X refers to nonpolar amino acid and the nonpolar amino acid includes alanine, valine, leucine, isoleucine, proline or phenylalanine; while Y refers to polar amino acid and the polar amino acid is glycine, serine, threonine, cysteine, tyrosine, asparagine, glutamine, aspartic acid or glutamic acid. An in vitro platelet aggregation test and an in vivo thrombosis test show that the small peptide can restrain platelet aggregation in a concentration dependent way and simultaneously can remarkably restrain thrombosis of artery-vein bypass in bodies of rats. The small peptide and derivatives of the small peptide can be used for resisting platelet aggregation and thrombosis in treatment. The small peptide can be used for preparing medicaments resisting thrombosis and platelet aggregation.
Owner:SOUTHEAST UNIV

Stable pharmaceutical composition for atherosclerosis

The present invention relates to a stable solid oral pharmaceutical multi-component composition comprising combination of blood pressure lowering drugs with lipid lowering agent / s and optionally a platelet aggregation inhibitor in a single dosage form. The blood pressure lowering agents are selected from β-adrenergic receptor blocking agent, ACE inhibitor and diuretic. The lipid lowering agent is selected from HMG Co-enzyme-A reductase inhibitor. The pharmaceutical composition made as per present invention a) overcomes any drug-drug interactions, b) exhibits pharmacokinetic and pharmacodynamic profile of individual therapeutic agent, c) has minimal side effects. The invention provides multi-component composition (MCC) to increase adherences to therapy. The MCC as per present invention provides compositions that maintain activity of all active ingredients without significant increase in adverse event profile. The present invention further relates to a method of preparing the said pharmaceutical composition.
Owner:CADILA PHARMA

Novel acetysalicylic acid formulations

The invention relates to pharmaceutical compositions of acetylsalicylic acid-based microcapsules to selectively inhibit the COX in the portal vein and / or in the liver to reduce the production of thromboxane. Further, the pharmaceutical composition minimizes COX inhibition in the systemic circulation to optimize the inhibition of platelet aggregation. Certain embodiments also address methods of prevention and / or treatment of these diseases, using these oral compositions such as enhancing the safety of antithrombotic treatments. Other embodiments contemplate oral pharmaceutical compositions that combine acetylsalicylic acid with anti-platelet aggregation drugs, without inducing gastric side effects.
Owner:NEW HAVEN PHARMA

Stabilized L-Arginine platelet aggregation inhibitory compositions and processes for making same

Linking Magnesium ions to Nitric Oxide precursor L-Arginine, chemically 2-amino-5-guanidino valeric acid, with a platelet aggregation inhibitor compound such as, but not limited to acetylsalicylic acid or clopidogrel bisulfate, unexpectedly results in a pharmaceutically stabilized compositions with extended shelf life to be taken orally to provide gradual release vasodilatory and anti-platelet aggregation pharmacological activity with reduced potential for producing gastrointestinal lesions. L-Arginine releases ADNO (Arginine derived Nitric Oxide) in the coronary artery epithelium as EDRF (endothelium dependent relaxing factor) to dilate the arteries to promote blood flow to the myocardium, and the platelet aggregation inhibitor such acetylsalicylic acid or clopidogrel and others of this class of drugs inhibits or antagonizes the aggregation adhesion of platelets in the blood stream. Aggregated or clumped blood platelets contribute to arterial stenosis due to formation of atherosclerotic plaques that occlude coronary and other circulatory arteries. In addition to coronary arteries, atherosclerotic plaques can occlude and stenose carotid arteries and femoral arteries due to aggregated or clumped blood platelets, and the subject of this patent discovery will also be of cardiovascular health benefit respectively in preventing carotid cerebrovascular accidents and femoral artery leg circulation disease.
Owner:KAPLAN LEONARD L

Nanoparticulate and controlled release compositions comprising a platelet aggregation inhibitor

InactiveCN101287451AImprove conveniencePrevention and treatment of ischemic symptomsBiocideNanomedicineControlled releaseNanoparticle
The present invention provides a composition comprising a platelet aggregation inhibitor, for example, cilostazol, or a salt or derivative thereof, useful in the treatment and prevention of ischemic symptoms. The invention provides a composition which comprises nanoparticulate particles comprising the platelet aggregation inhibitor and at least one surface stabilizer. The nanoparticulate particles have an effective average particle size of less than about 2000 nm. The invention provides also a composition that delivers a platelet aggregation inhibitor, or nanoparticles comprising the same, in a pulsatile or continuous manner.
Owner:ELAN PHRMA INT LTD

Blood withdrawal device

The invention relates to a blood withdrawal device (10) having an active liquid (12) containing a platelet aggregation inhibitor, a microneedle patch (14) having a plurality of microneedles (20), wherein a plurality of microneedles (20) is configured for dispensing the active liquid (12) into the skin (34) of a patient, and comprising a negative pressure generating device (16) connected to a plurality of microneedles (20) such that blood (46) can be drawn from the skin (34) by means of the microneedles (20). According to the invention the active liquid (12) contains a pain killer, the active liquid (12) is arranged in the blood reservoir (18), and the negative pressure generating device (16) is connected to the blood reservoir (18) such that by generating an excess pressure in the blood reservoir (18), the active liquid (12) can be dispensed by way of microneedles (20), and by generating a negative pressure, blood (46) can be drawn into the blood reservoir (18).
Owner:P·勒尔 +2

A beta aggregation inhibitor

The invention discloses an A beta aggregation inhibitor. The aggregation inhibitor is characterized in that: the amino acid sequence of the aggregation inhibitor is amino terminal-IYVLIY-carboxyl terminal. The peptide sequence is designed based on a quantitative structure function relational model of peptide and is obtained through technical detection of microscope scan. The aggregation inhibitor has a good effect of inhibiting the aggregation of the toxic body, namely A beta capable of causing Alzheimer's disease and can be further developed into a medicament for treating the Alzheimer's disease.
Owner:CHONGQING UNIV

Quinolone derivative or salt thereof

InactiveUS20090124617A1Improve securitySmall adverse bleeding effectBiocideSurgical drugsQuinoloneMedicine
A platelet aggregation inhibitor comprising a quinolone derivative or a pharmaceutically acceptable salt thereof as an active ingredient, and a novel quinolone derivative or a pharmaceutically acceptable salt thereof useful as a platelet aggregation inhibitor.
Owner:ASTELLAS PHARMA INC

Cyclic ketone derivatives and applications thereof as developers and aggregation inhibitors of amyloid protein sediments and neurofibrillary tangles

The invention relates to applications of compounds of formulas (1)-(58), or pharmaceutically-acceptable salts, esters, amides or prodrugs thereof as developers and aggregation inhibitors of amyloid protein sediments and neurofibrillary tangles, a preparation method labeled compounds for imaging, and a method for transporting the compounds to amyloid protein sediments and neurofibrillary tangles. When serving as the developers used to detect the amyloid protein sediments and neurofibrillary tangles in body and tissue, the compounds need to use appropriate radioisotopes or contrast agents suitable for magnetic resonance detection to be labeled. The compounds of the invention are applied to diagnose and treat patients suffering from amyloid protein sediments and neurofibrillary tangles and Alzheimer disease.
Owner:UNIV OF SCI & TECH OF CHINA
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More