Application of Tat-SPK2 peptide in prevention and treatment of cardiac hypertrophy or heart failure

A technology for myocardial hypertrophy and heart failure, applied in the field of medicine, can solve the problems of increasing the mortality rate of heart failure, increasing arrhythmia, serious problems, etc., and achieve the effect of reducing cardiomyocyte hypertrophy, reducing heart mass index, and preventing occurrence and development

Active Publication Date: 2018-12-18
SUZHOU UNIV
View PDF1 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The above 1-4 types of drugs alleviate or reverse myocardial hypertrophy, gradually improve cardiac function, and are suitable for long-term treatment of myocardial hypertrophy or chronic heart failure, but the course of treatment is longer, and the curative effect on acute heart failure is limited
The fifth category of inotropic drugs, cardiac glycosides and non-glycoside inotropic drugs, have many and serious adverse reactions in clinical application, which increase the risk of arrhythmia and even increase the mortality rate of heart failure.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of Tat-SPK2 peptide in prevention and treatment of cardiac hypertrophy or heart failure
  • Application of Tat-SPK2 peptide in prevention and treatment of cardiac hypertrophy or heart failure
  • Application of Tat-SPK2 peptide in prevention and treatment of cardiac hypertrophy or heart failure

Examples

Experimental program
Comparison scheme
Effect test

Embodiment

[0022] Example: A Tat-SPK2 peptide for the treatment of myocardial hypertrophy or heart failure and its application

[0023] The amino acid sequence of the Tat-SPK2 peptide from N-terminal to C-terminal is YGRKKRRQRRRGGSGDGLLYEVLNGLLDRPD. This example relates to the application of Tat-SPK2 peptide in the preparation of drugs for the treatment of human cardiac hypertrophy or heart failure. For the treatment of human cardiac hypertrophy or heart failure, the Tat-SPK2 peptide can be administered by intravenous injection or intravenous infusion, with a dose of 40µg ~1mg / kg / d (referring to the daily dosage per kilogram of body weight 40µg~1mg).

[0024] According to the BH3 functional domain of SPK2, the Tat-SPK2 polypeptide was designed and synthesized (China Peptide Biochemical Co., Ltd., purity 95%): the 11 amino acids at the N-terminal of Tat-SPK2 are composed of Tat transmembrane sequence (PTD), and the middle is connected by 2 glycines , the C-terminal 18 amino acid sequenc...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a Tat-SPK2 peptide for treatment of cardiac hypertrophy or heart failure and application thereof. The amino acid sequence of the Tat-SPK2 peptide from N terminal to C terminalis YGRKRRQRRRGGSGDGLLYEVLNGLLDRPD. The Tat-SPK2 peptide can be applied to preparation of drugs treating human cardiac hypertrophy or heart failure. The Tat-SPK2 peptide can alleviate isoprenaline-induced cardiac hypertrophy in mice, has preventive and therapeutic effects on cardiac hypertrophy or heart failure, and the cardioprotective mechanism has no connection with autophagy, and is generatedby up-regulation of SIRT3 and Bcl-2 and down-regulation of BNIP3.

Description

technical field [0001] The invention relates to the technical field of medicine, in particular to an application of Tat-SPK2 peptide in preventing and treating myocardial hypertrophy or heart failure. Background technique [0002] Cardiac hypertrophy (cardiac hypertrophy), especially left ventricular hypertrophy (Left ventricular hypertrophy, LVH) is the target organ response of the heart to chronic pressure or volume overload, and is seen in hypertension, valvular disease, acute myocardial infarction, and congenital heart disease. There are about 266 million hypertensive patients in my country, and one-third of hypertensive patients may be accompanied by LVH. Myocardial hypertrophy is an extremely important cardiovascular risk factor, which can increase the probability of sudden death such as coronary heart disease, stroke or transient ischemic heart attack. More importantly, cardiac hypertrophy is also one of the important mechanisms for the occurrence and development of ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A61K38/16A61P9/04
CPCA61K38/16A61P9/04
Inventor盛瑞陈佳丽张晨阳钱柯
OwnerSUZHOU UNIV