A production method for promoting cytokine production in stem cells
A cytokine and stem cell technology, applied in the field of promoting the production of stem cell cytokines, can solve the problems of not verifying the adipogenic differentiation of bone marrow mesenchymal stem cells, and not involving the production and enrichment of cytokines, and achieve the effect of promoting high secretion
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0019] Example 1 Preparation of monoclonal antibodies specific for PTN
[0020] The optimized PTN highly immunogenic epitope peptide sequence rtgaeckqtmktqrckipcnwkkqfgaeckyqfqawgecdlntalktrtg was synthesized and used for later use. Animal Immunization: Four 7-week-old female Balb / c mice were taken, and the antigen was fully emulsified with an equal volume of Freund's adjuvant at a dose of 50 μg / mice, and then injected subcutaneously at multiple points in the abdomen, and boosted immunization every 2 weeks. Seven days after the third immunization, the immunized mouse serum was collected by enucleating the eyeball method, which was the immune serum (positive serum). Another free mouse serum was collected as negative serum. On the 7th day after 3 times of immunization, blood was collected from the tail vein, and the serum titer of mice was determined by ELISA. 10μg / mL, coated at 4°C for 12h; 50mg / L nonfat dry milk was blocked at 37°C for 1h; mouse serum was diluted with PBST, ...
Embodiment 25
[0024] Example 2 Subtype identification of 5H2 monoclonal antibody
[0025]Sigma's Mouse Monoelonal Antibody Isotyping Kit was used for identification. The hybridoma cells and mouse ascites were taken and diluted 1:10 with PBS with pH 7.2; 200 μL of the dilution was added to the test tube, kept at room temperature for 30 s, the Isotrip colloidal gold test paper was inserted into the bottom of the tube, taken out after 10 minutes, and the results were observed. The results showed that the antibody subtype of 5H2 monoclonal antibody was IgG1, and the light chain type was κ.
Embodiment 3
[0026] Example 3 Affinity identification and sequence identification of 5H2 monoclonal antibody
[0027] The affinity was determined by surface plasmon resonance (Surface Plasmon Resonance, SPR). For the immobilization of the capture molecule (anti-mouse Fc fragment capture antibody), the channel immobilized with the anti-mouse Fc fragment capture antibody is used as the detection channel, and the channel without the anti-mouse Fc fragment capture antibody is used as the control channel. The process is as follows: (1) Surface equilibration: HBS-EP buffer, equilibrate the chip surface at a flow rate of 15μl / min for 5min; (2) Surface activation: inject 'NHS+EDC' 1:1 mixture, activate the chip surface at a flow rate of 15μl / min for 7min; (3) Coupling Coupling antibody: inject goat anti-mouse Fc fragment capture antibody (diluted in 10 mM sodium acetate (pH 4.5) buffer), and couple at a flow rate of 15 μl / min for 6 min; control channel omit this step; (4) Surface blocking: inject ...
PUM
| Property | Measurement | Unit |
|---|---|---|
| affinity | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 



