Production method for promoting yield of stem cell cytokines
A cytokine and stem cell technology, applied in the field of promoting the production of stem cell cytokines, can solve the problems of not verifying the adipogenic differentiation of bone marrow mesenchymal stem cells, and not involving cytokine production and enrichment.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0019] Embodiment 1 is specific to the preparation of the monoclonal antibody of PTN
[0020] The optimized PTN highly immunogenic epitope peptide sequence rtgaeckqtmktqrckipcnwkkqfgaeckyqfqawgecdlntalktrtg was synthesized for later use. Animal immunization: 4 7-week-old female Balb / c mice were taken, and the antigen was fully emulsified with an equal volume of Freund's adjuvant at a dose of 50 μg / mouse, and then subcutaneously injected into the abdomen at multiple points, and the immunization was boosted once every 2 weeks. Seven days after the third immunization, the serum of the immunized mice was collected by picking the eyeball method, which was the immune serum (positive serum). In addition, serum from unimmunized mice was collected as negative serum. On the 7th day after the 3 times of immunization, blood was collected from the tail vein, and the titer of mouse serum was determined by ELISA detection method. 10μg / mL, coated at 4°C for 12h; 50mg / L skimmed milk powder, ...
Embodiment 25
[0024] Example 2 Identification of 5H2 monoclonal antibody subtypes
[0025]The Mouse Monoelonal Antibody Isotyping Kit from Sigma was used for identification. Take hybridoma cells and mouse ascites, and make 1:10 dilution with PBS of pH 7.2; take 200 μL of the diluted solution and add it to the test tube, let it stand at room temperature for 30 seconds, insert the Isotrip colloidal gold test paper into the bottom of the tube, take it out after 10 minutes, and observe the result. The results showed that the antibody subtype of 5H2 monoclonal antibody was IgG1, and the light chain type was κ.
Embodiment 3
[0026] Example 3 Affinity Identification and Sequence Identification of 5H2 Monoclonal Antibody
[0027] The affinity was determined by Surface Plasmon Resonance (SPR). Immobilization of the capture molecule (anti-mouse Fc fragment capture antibody), the channel with the anti-mouse Fc fragment capture antibody immobilized as the detection channel, and the channel with the unfixed anti-mouse Fc fragment capture antibody as the control channel, the process is as follows: (1) surface balance: HBS-EP buffer solution, equilibrate the chip surface at a flow rate of 15 μl / min for 5 min; (2) surface activation: inject a 1:1 mixture of 'NHS+EDC', activate the chip surface at a flow rate of 15 μl / min for 7 min; (3) couple Coupled antibody: inject goat anti-mouse Fc fragment capture antibody (diluted in 10mM sodium acetate (pH 4.5) buffer), couple at a flow rate of 15μl / min for 6min; control channel omit this step; (4) surface blocking: inject ethanolamine , the surface was blocked for ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


