Method for effectively improving production of bone marrow mesenchymal stem cell cytokines

A bone marrow mesenchymal and cytokine technology, which is applied in the field of effectively improving the cytokine production of bone marrow mesenchymal stem cells, can solve the problems of not involving the production and enrichment of cytokines, and not verifying the adipogenic differentiation of bone marrow mesenchymal stem cells.

Active Publication Date: 2021-03-26
上海杏道生物科技有限公司
View PDF3 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0005] However, in the prior art, there is no verification of the promotion of adipogenic differentiation after rapid proliferation of bone marrow mesenchymal stem cells, detection of changes in corresponding cytokines, and no research involving the production and enrichment of corresponding cytokines

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Method for effectively improving production of bone marrow mesenchymal stem cell cytokines
  • Method for effectively improving production of bone marrow mesenchymal stem cell cytokines
  • Method for effectively improving production of bone marrow mesenchymal stem cell cytokines

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0019] Example 1 Preparation of monoclonal antibodies specific to PTN

[0020] The optimized PTN highly immunogenic epitope peptide sequence rtgaeckqtmktqrckipcnwkkqfgaeckyqfqawgecdlntalktrtg is synthesized and ready for use. Animal immunization: Four 7-week-old female Balb / c mice were taken, and the antigen was fully emulsified with an equal volume of Freund's adjuvant at a dose of 50 μg / mouse, and injected subcutaneously at multiple points in the abdomen, and boosted every 2 weeks. Seven days after the third immunization, the serum of the immunized mice was collected by picking the eyeball method, which was called the immune serum (positive serum). In addition, serum from unimmunized mice was collected as negative serum. On the 7th day after the 3 times of immunization, blood was collected from the tail vein, and the titer of mouse serum was determined by ELISA detection method. 10μg / mL, coated at 4°C for 12h; 50mg / L skimmed milk powder, blocked at 37°C for 1h; mouse serum...

Embodiment 21A7

[0024] Example 2 Identification of 1A7 monoclonal antibody subtype

[0025]The Mouse Monoelonal Antibody Isotyping Kit from Sigma was used for identification. Take hybridoma cells and mouse ascites and dilute them with PBS at pH 7.2 to make a 1:1O dilution; take 200 μL of the diluted solution and add it to the test tube, let it stand at room temperature for 30 seconds, insert the Isotrip colloidal gold test paper into the bottom of the tube, take it out after 10 minutes, and observe the results . The results showed that the antibody subtype of 1A7 monoclonal antibody was IgG1, and the light chain type was κ.

Embodiment 31A7

[0026] Example 3 Affinity Identification and Sequence Identification of 1A7 Monoclonal Antibody

[0027] The affinity was determined by Surface Plasmon Resonance (SPR). Immobilization of the capture molecule (anti-mouse Fc fragment capture antibody), the channel with the anti-mouse Fc fragment capture antibody immobilized as the detection channel, and the channel with the unfixed anti-mouse Fc fragment capture antibody as the control channel, the process is as follows: (1) surface balance: HBS-EP buffer, equilibrate the chip surface at a flow rate of 10 μl / min for 5 min; (2) surface activation: inject a 1:1 mixture of 'NHS+EDC', activate the chip surface at a flow rate of 10 μl / min for 7 min; (3) couple Coupled antibody: inject goat anti-mouse Fc fragment capture antibody (diluted in 10mM sodium acetate (pH 4.5) buffer), couple at a flow rate of 10μl / min for 7min; control channel omit this step; (4) surface blocking: inject ethanolamine , block the surface for 7 min at a flow...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a method for effectively improving production of bone marrow mesenchymal stem cell cytokines. The method uses a monoclonal antibody capable of specifically aiming at PTN, andthe antibody can effectively induce adipogenic differentiation of bone marrow mesenchymal stem cells, and can efficiently promote high secretion of SCF and VEGF cytokines after differentiation. High-yield cytokines can be used for subsequent research through separation and purification.

Description

technical field [0001] The present application relates to the field of biology, and more specifically, relates to a method for effectively increasing cytokine production of bone marrow mesenchymal stem cells. Background technique [0002] Mesenchymal stem cells (MSCs) are important members of stem cell family, not only exist in bone marrow, fat, umbilical cord blood and peripheral blood, but also in perichondrium, periosteum, muscle and trabecular bone. Bone marrow mesenchymal stem cells (BMSCs) are the most studied at present. Its basic characteristics are: self-renewal ability, can proliferate to form tissue and maintain its own quantity in vivo, and can clone growth in vitro. Proliferation and differentiation ability, under the induction of certain environment and specific factors, can differentiate into tissues such as muscle, nerve, cartilage, bone, fat, tendon and ligament. BMSCs have become the most commonly used seed cells for bone tissue engineering research becau...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C12N5/0775C12N5/077C07K16/22C12P21/02
CPCC07K14/475C07K14/515C07K16/22C07K2317/56C07K2317/92C12N5/0653C12N5/0663C12N2500/40C12N2501/10C12N2501/33C12N2501/39C12N2501/999C12N2506/1353
Inventor张海涛李娜
Owner上海杏道生物科技有限公司