Tumor necrosis targeting compositions and methods
A technology that targets tumor cells and is used in drug combinations, anti-tumor drugs, pharmaceutical formulations, etc., and can solve problems such as no known therapeutic interventions
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
example
[0043] sequencing : NANT-1 antibody sequence information was derived from mRNA of NANT-1 producing hybridoma cells (murine) following standard protocols well known in the art. murine IgG 1 The sequences of the isotypes are known, and only the variable heavy and light chain information is provided below, with the corresponding CDR regions underlined:
[0044] Heavy Chain Variable Region Sequence (SEQ ID NO:2):
[0045] QESGPQLVRPGASVKISCKAS GYSFTSY WMHWVKQRPGQGLEWIGMI DPSDSE TRLNQKFKDKATLTVDKSSSTAYMQLNSPTSEDSAVYYCAR DGGYYAWFAY WGQGTLVTVSA
[0046] Light chain variable region sequence (SEQ ID NO:3):
[0047] DIVLTQTPKSMSMSVCJERVTLTC KASENVVTYVS WYVQKPEQSPKLLIY GASNRYT GVPDRFTGSGSATDFLTISSVQAEDLADYHC GQGYSYPYT FGGGTKLEIKRA
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



