Eureka AIR delivers breakthrough ideas for toughest innovation challenges, trusted by R&D personnel around the world.

Polypeptide used for preventing and treating diabetes and lipid metabolic disturbance

A technology for lipid metabolism disorders and diabetes, applied in the field of biomedicine, can solve problems such as subcutaneous fat atrophy, incompletely clear pathogenesis, and difficult treatment

Inactive Publication Date: 2011-04-27
HUAZHONG UNIV OF SCI & TECH
View PDF3 Cites 19 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Due to the complex etiology of diabetes, the pathogenesis is not completely clear, which brings great difficulties to the treatment.
[0004] At present, the main treatment for diabetes is insulin injection. Since insulin is a water-soluble polypeptide that is easily degraded by enzymes in the gastrointestinal tract, it is not suitable for oral administration; and insulin therapy for diabetic patients requires daily subcutaneous injection of insulin for life. , long-term frequent injections not only bring pain to patients, but also may produce various adverse reactions such as subcutaneous fat atrophy
In addition, long-term insulin therapy has the risk of hypoglycemia

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polypeptide used for preventing and treating diabetes and lipid metabolic disturbance
  • Polypeptide used for preventing and treating diabetes and lipid metabolic disturbance
  • Polypeptide used for preventing and treating diabetes and lipid metabolic disturbance

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0065] Preparation of the polypeptide of the present invention

[0066] Soak the peas in 0.5M acetic acid overnight, beat the pulp, refrigerate and centrifuge the slurry, absorb the centrifuged supernatant with alginic acid, then elute with 0.2M hydrochloric acid, repeat the adsorption and elution operation 3 times, and carry out salting out of the eluent, salting out After the product is desalted through the G-25 column, the liquid after the desalination is filtered through the G-50 column, and the filtrate is freeze-dried and concentrated, and is separated by HPLC (see figure 2 ), take peak 3, peak 4, peak 5, and the substance in peak 7 to obtain the polypeptide of the present invention. Protein sequencing was performed on the obtained polypeptide, and the results are as follows:

[0067] Peptide 1 (peak 3) ASCNGVCSPFEMPPCGSSACRCIPVGLVVGYCRHPSG (37)

[0068] Peptide 2 (Peak 4) ISCNGVCSPFDIPPCGTPPLCRCIPAGLFVGKCRHPYG(37)

[0069] Peptide 3 (peak 5) VSCNGVCSPFDIPPCGTPPLCRCI...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a polypeptide used for preventing and treating diabetes and lipid metabolic disturbance. The polypeptide has obvious curative effect to type II diabetes, the blood sugar reducing function is realized on the basis of hyperglycemia, and the blood sugar concentration is reduced by virtue of glucose, thus being capable of not causing hypoglycaemia, having good safety and protecting pancreas beta cells. The polypeptide also has the function of obviously reducing triacylglyceride in blood and can be taken as a medicine used for preventing and treating diabetes and lipid metabolic disturbance. The polypeptide is resistant to enzymolysis, thus being applicable to being developed into oral preparations.

Description

technical field [0001] The invention belongs to the field of biomedicine and relates to medicines for preventing and treating diabetes and lipid metabolism disorders. technical background [0002] Diabetes is caused by genetic factors, immune dysfunction, microbial infection and its toxins, free radical toxins, mental factors and other pathogenic factors that act on the body to cause hypofunction of pancreatic islets and insulin resistance (Insulin Resistance, IR), etc. A series of metabolic disorder syndromes such as sugar, protein, fat, water and electrolytes caused. Diabetes has become the third largest "health killer" after cancer and cardiovascular and cerebrovascular diseases. With economic development, increasing obesity and aging of human structure, the incidence of diabetes continues to increase. [0003] In 1980, the World Health Organization (WHO) divided diabetes into: insulin-dependent diabetes mellitus (IDDM, also known as type I), non-insulin-dependent diabe...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/415A61K38/16A61P3/10A61P3/06
CPCA61K38/56A61P3/06A61P3/10
Inventor 陈正望杜仲夏盖文丽贾绍辉陆婕顿新鹏颜冬菁陈磊万定一
Owner HUAZHONG UNIV OF SCI & TECH
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com