New application of lymphotoxin derivative
A technology of lymphotoxin and derivatives, which can be used in medical preparations containing active ingredients, antidote, drug combinations, etc., and can solve problems such as lack of protective measures and treatment methods, in-depth application research, and adverse reactions.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0038] The preparation of embodiment 1 LT008
[0039] It is prepared according to the process of Example 1 of the patent document whose publication number is CN101084238B, and its amino acid sequence (SEQ ID NO: 1) is:
[0040] MHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSEYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL.
Embodiment 2
[0041] Example 2 LT008 can promote the recovery of nuclear radiation-induced damage in wild-type C57BL / 6 mice in vivo
[0042] 2.1 Research Methods
[0043] Wild C57BL / 6 mice were quarantined and raised in the SPF animal room for 3 weeks after purchase. Before grouping, the mice were weighed with BS124 balance, numbered and marked by ear tag method, and randomly grouped according to body weight. They were divided into PBS control group (W1) and LT008 group (W2), with 20 rats in each group, half male and half male, for the determination of survival rate. In addition, PBS control group (W3) and LT008 group (W4) were used, with 60 rats in each group, half male and half male, for the study of hemogram, bone marrow cytology, bone marrow pathology and related mechanisms.
[0044] All mice in the LT group were given 250 µg / kg LT008 by tail vein injection for three consecutive days after 75% alcohol disinfection two days before and on the day of irradiation. The administration conce...
Embodiment 3
[0059] Example 3 In vitro protective effect of LT008 on human monocyte THP-1 damage caused by nuclear radiation
[0060] 3.1 LT008 can promote the proliferation of THP-1 cells and promote the survival of THP-1 cells under irradiation
[0061] (1) Method: THP-1 cells were treated with different concentrations of LT008 (0, 0.1, 1, 10 and 50 μg / mL) for different times (0, 1, 4, 8, 24, 48 and 72 hours) and then the cells were processed. The cell proliferation curve was counted; the cells were irradiated with a total of 6 Gy 60Co-γ immediately after the above-mentioned different concentrations of LT008 (1.63 Gy / min), 0, 1, 4, 8, 24, 48, 72 h for cell counting and cell proliferation curves. see results Figure 13 .
[0062] (2) Test results: the results are as follows Figure 13 As shown in A, compared with the control group, the number of cells treated with 0-10 μg / mL LT008 did not change significantly at different times, but the number of THP-1 cells began to increase signific...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


