Supercharge Your Innovation With Domain-Expert AI Agents!

A kind of method for producing all male Macrobrachium rosenbergii seeds

A technology of Macrobrachium rosenbergii and shrimp seedlings, applied in the field of genetic engineering, can solve the problems of low reversal efficiency, limited promotion, low efficiency of false female shrimp, etc., and achieve the effect of improving success rate and reducing infection mortality

Active Publication Date: 2022-02-15
ZHEJIANG INST OF FRESH WATER FISHERIES
View PDF9 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, due to the high import cost, long intermediate process and high mortality rate, its promotion in the Chinese market is limited; the existing domestic gene seed production method uses microinjection of fertilized eggs or early-stage larvae muscle, which has a high mortality rate and is difficult to prepare. The efficiency of false female shrimp is low, which is not conducive to large-scale production; the method of removing the androgenic glands is cumbersome to operate, the reversal efficiency is low, and the mortality rate is high; the market needs a method that can solve the demand for all male Macrobrachium rosenbergii seedlings in production. Method for Seed Production of All Male Macrobrachium rosenbergii

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of method for producing all male Macrobrachium rosenbergii seeds
  • A kind of method for producing all male Macrobrachium rosenbergii seeds
  • A kind of method for producing all male Macrobrachium rosenbergii seeds

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0039] The present invention will be specifically introduced below in conjunction with the accompanying drawings and specific embodiments.

[0040] Macrobrachium rosenbergii sex regulation gene: Macrobrachium rosenbergii DMRT1 mRNA

[0041] Amino acid sequence:

[0042] "MECGGYESEGKGKRKQHCTYCKNHGKKSRKTNHKCEHEECECLLCKLTRLSRLIMRHQQRLWRHLKDSKRRQNAAADAGGTAAGSGACEPSGEHTDSSGAAQGASSTKLQKCDMCRNHGEIMSKRAHKNACPYQDCPCELCSLTRKRRYIMXLQQRVRRSQVXSKQHNEVWEYVTQATAELEFLGLQDIHQTTEDHNASSSLSESSSSPSPDSSSTSGSLPHKPEVIXPNPVTPTXPAXTNRTRSKDTESSPVPMDMPPLEPLPECSPTRYSPRPPAPPFNVPSPAATSRIRTSYPSPPPPNPLPPNRGLTNVPPMEIEPAWMNLKREREEVLKMNPKVQTREENLFGHLDFMKDQLTMTGRLEPPVPPEGSRSFHNTAVAMNFGSSHVPPYKSLVPMIDTNHLPPPPLQKSRADCNLHFQYRSMVWGNVPTEPSVGFVPDDFQQQCYRSLLVNNADVRVQPPPGLIQIPRPQHPLRPRPLAPVRPHVLPVNVECDHVNLHYLAYFLQNQREHYRDTLSTLSTTRSFGLPREALFLHHPVP"

[0043] Nucleotide sequence:

[0044]cactgctacactgcgtctgcgcaaacgacctcgagatggagtgcgggggctacgagagcgagggcaagggcaagaggaagcagcactgcacctactgcaagaaccacgggaagaagagtcgcaagaccaaccacaag...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a method for seed production of all male Macrobrachium rosenbergii, comprising: step 1, designing and synthesizing siRNA targeting DMRT1; step 2, transfecting the shrimp seedlings with the obtained siRNA, and extracting the RNA of the disturbed shrimp seedlings Prepare cDNA by reverse transcription, and use real-time fluorescent quantitative PCR to detect the expression of DMRT1 and IAG genes after RNA interference; Step 3, detection and screening of "false female" parents; Step 4, cultivation and verification of all male Macrobrachium rosenbergii; Step 5, The subculture of all male Macrobrachium rosenbergii female parent "pseudo-female" shrimp; the invention can solve the problems of low reversal rate of all male Macrobrachium rosenbergii and high mortality rate in the interference process; the proportion of males in the offspring of produced shrimp is high, and the breeding effect is good.

Description

technical field [0001] The invention relates to the field of genetic engineering, in particular to a method for seed production of all male Macrobrachium rosenbergii. Background technique [0002] Macrobrachium rosenbergii has a significant difference between male and female. The male shrimp grows faster and has a larger individual, which has a growth advantage. In the market, prawns are popular in many places. Therefore, the breeding of all male Macrobrachium rosenbergii has broad market prospects. Although Israel has begun to use RNAi technology to interfere with the IAG gene to produce "false female" Macrobrachium rosenbergii and the resulting all-male strain. However, due to the high import cost, long intermediate process and high mortality rate, its promotion in the Chinese market is limited; the existing domestic gene seed production method uses microinjection of fertilized eggs or early-stage larval muscle, and the mortality rate is high. The efficiency of false fe...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N15/113
CPCA01K61/59C12N15/113C12N2310/14Y02A40/81
Inventor 徐宾朋陈雪峰高强彭菲程海华
Owner ZHEJIANG INST OF FRESH WATER FISHERIES
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More