Polypeptide for inhibiting novel coronavirus infection and screening method thereof
What is Al technical title?
Al technical title is built by PatSnap Al team. It summarizes the technical point description of the patent document.
A coronavirus, screening method technology, applied in the direction of viral peptides, viruses, antiviral agents, etc., to achieve the effect of inhibiting the invasion of cells
Pending Publication Date: 2020-08-21
哈尔滨吉象隆生物技术有限公司
View PDF1 Cites 20 Cited by
Summary
Abstract
Description
Claims
Application Information
AI Technical Summary
This helps you quickly interpret patents by identifying the three key elements:
Problems solved by technology
Method used
Benefits of technology
Problems solved by technology
As a new emerging infectious disease, there is no clinically specific drug for the treatment of novel coronavirus pneumonia. At present, symptomatic treatment is mainly used, and on this basis, complications are actively prevented and organ functions are supported in a timely manner.
Method used
the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more
Image
Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
Click on the blue label to locate the original text in one second.
Reading with bidirectional positioning of images and text.
Smart Image
Examples
Experimental program
Comparison scheme
Effect test
Embodiment 1
[0048] Example 1 Screening and Identification of Polypeptides Inhibiting Novel Coronavirus Infection
[0049] (1) Download the S protein gene sequence of the new coronavirus SARS-CoV-2 from the NCBI website (Genebank: YP_009724390.1).
[0050] (2) Enter the S protein gene sequence of the new coronavirus SARS-CoV-2 into Antheprot 6.9.3 software, predict its functional domain, analyze the secondary structure of the protein, and determine the signal peptide cleavage site, folding situation, transmembrane Area.
[0051] (3) Find the HR1 region and HR2 region of the S protein region of SARS-CoV-2 according to the above analysis combined with sequence homology alignment.
[0052] The amino acid sequence of the HR1 region is: TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRL; SEQ ID NO.11;
[0053] The amino acid sequence of the HR2 region is: PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWSEQ ID NO.12;
[0054] (4) Select the natural peptide segment co...
Embodiment 2
[0073] Example 2 Evaluation of Peptide Activity Inhibiting Novel Coronavirus Infection
[0074] Represented by polypeptide 1 and polypeptide 5, the interaction between it and the HR1 region (HR1P) of the new coronavirus SARS-CoV-2 was detected, and its activity was evaluated. Polypeptide 1 is a wild-type polypeptide, and polypeptide 5 is a mutant polypeptide. By comparing polypeptide 1 and polypeptide 5, the performance of the mutant polypeptide can be evaluated.
[0075] (1) Non-denaturing polyacrylamide gel electrophoresis
[0076] Mix HR1P with peptide 1 and peptide 5 respectively (final concentration of 35 μM each). Using HR1P, peptide 1 and peptide 5 as controls, incubate at 37°C for 30 min, then add 5× loading buffer (pH 8.3), Electrophoresis was performed at 125V constant voltage at room temperature for 2 hours in non-denaturing gel with a mass concentration of 18%, and Coomassie brilliant blue staining was performed.
[0077] The binding ability of polypeptide 1 and...
the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more
PUM
Login to view more
Abstract
The invention discloses a polypeptide for inhibiting novel coronavirus infection and a screening method thereof, which belong to the technical field of biological medicine. The screening method comprises the following steps: obtaining an S protein gene sequence of the novel coronavirus SARS-CoV-2; determining an HR1 region and an HR2 region of an S protein region of the novel coronavirus SARS-CoV-2; selecting a natural peptide fragment consisting of 30-36 amino acids in the HR2 region as a polypeptide for inhibiting novel coronavirus infection; on the basis of the natural peptide fragment, glutamic acid-lysine or glutamic acid-arginine pairs are designed through site-specific mutagenesis to form a polypeptide chain inner salt bridge. Compared with the prior art, the polypeptide for inhibiting the novel coronavirus infection has the beneficial effects that the polypeptide for inhibiting the novel coronavirus infection can form a stable 6-HB spiral structure with HR1P and has the capability of inhibiting the novel coronavirus infection from invading cells.
Description
technical field [0001] The present invention relates to the technical field of biomedicine, and more specifically relates to a polypeptide for inhibiting novel coronavirus infection and a screening method thereof. Background technique [0002] Coronaviruses are a class of RNA viruses with an envelope and a linear single-stranded positive strand genome. They are a large class of viruses that exist widely in nature. Coronaviruses only infect vertebrates and are related to a variety of diseases in humans and animals, and can cause diseases of the respiratory system, digestive system and nervous system in humans and animals. [0003] The new coronavirus SARS-CoV-2 has become the seventh coronavirus to infect humans after HCoV-229E, HCoV-OC43, HCoV-NL63, HCoV-HKU1, SARS-CoV, and MERS-CoV. As a new emerging infectious disease, there is no clinically specific drug for the new type of coronavirus pneumonia. At present, symptomatic treatment is mainly used, and on this basis, compli...
Claims
the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more
Application Information
Patent Timeline
Application Date:The date an application was filed.
Publication Date:The date a patent or application was officially published.
First Publication Date:The earliest publication date of a patent with the same application number.
Issue Date:Publication date of the patent grant document.
PCT Entry Date:The Entry date of PCT National Phase.
Estimated Expiry Date:The statutory expiry date of a patent right according to the Patent Law, and it is the longest term of protection that the patent right can achieve without the termination of the patent right due to other reasons(Term extension factor has been taken into account ).
Invalid Date:Actual expiry date is based on effective date or publication date of legal transaction data of invalid patent.
Login to view more 
Login to view more