Recombinant rubella virus E1 protein and uses thereof
A rubella virus and protein technology, applied in the field of genetic engineering, can solve problems such as the difficulty in the separation and purification of antigenic component E1, the lack of research and development of commercial diagnostic kits, and the difficulty in the separation of antigenic components, so as to meet the needs of clinical diagnosis and sensitivity High and specific effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0033] Example 1 Preparation of recombinant rubella virus E1 protein
[0034] The amino acid sequence of the recombinant rubella virus E1 protein is designed according to the amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1), and the sequence is 203-295 amino acids of the amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1).
[0035] 1.1 Synthesis of recombinant DNA of rubella virus E1 protein
[0036] The amino acid sequence of RV envelope glycoprotein E1 (glycoprotein E1) is analyzed by computer, combined with the confirmed antigenic epitope, and a part of the sequence with strong antigenicity is selected.
[0037] RV包膜糖蛋白E1(glycoprotein E1)氨基酸全序列如下:EEAFTYLCTAPGCATQAPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCEGLGAWVPAAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVEPAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTTEHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTG NQQSRWGLGSPNCHGPDWASPVCQRHS PDCSR LVGATPE RPRLRLVD ADDPL LR TAPGPGE VWVTP...
Embodiment 2
[0078] Example 2 Preparation and Performance Test of the Kit for Detecting Rubella Virus IgM Antibody Infection
[0079] 2.1 Preparation of a kit for detecting rubella virus IgM antibody infection
[0080] The recombinant rubella virus E1 protein prepared in Example 1 was used as the substrate for the preparation of the enzyme-labeled antigen of the kit, and the RVIgM antibody was detected by ELISA.
[0081] The kit was developed and used as follows:
[0082] 1) The principle of the kit: this strain uses anti-human IgM (μ chain) coated microwell plate, horseradish peroxidase (HRP) labeled recombinant rubella virus E1 as tracer, TMB chromogenic system, application capture The principle of the method is to detect the anti-rubella virus IgM antibody in human serum or plasma.
[0083] 2) The main components of the kit:
[0084] a) Pre-coated plates:
[0085] b) Coating solution: 0.05mol / l, carbonate buffer system with pH9.6
[0086] c) Blocking solution: composed of 0.01mol / L...
PUM
| Property | Measurement | Unit |
|---|---|---|
| Sensitivity | aaaaa | aaaaa |
| Sensitivity | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 