Kit for diagnosing tertian malaria and/or malignant malaria
A kit, technology for falciparum malaria, applied in the field of medical devices, can solve problems such as limiting the rapid and effective diagnosis of malaria
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment
[0118] 1. Preparation and Confirmation of Peptides
[0119] The polypeptides used in the examples were synthesized by Jill Biochemical (Shanghai) Co., Ltd. and confirmed by mass spectrometry. in,
[0120] SEQ ID NO: 1: (QEINEDDKSAHIQHEIVEVEEILPEDDKNE); molecular weight 3546.
[0121] SEQ ID NO: 2: (ILPEDKNEKVEHEIVEVEEILPEDKNEKGQ); molecular weight 3531.
[0122] SEQ ID NO: 3: (AQEKGLPEPTVTNEEYVEELKKGILDMGIK); molecular weight 3360.
[0123] SEQ ID NO: 4: (NFLNDLFKKNNKNDLDDFFKNEKEYDDLCD); molecular weight 3715.
[0124] SEQ ID NO: 5: (KGPEIIIEEVKEEIKKQVEDGIKEENDTEGN); molecular weight 3412.
[0125] SEQ ID NO: 6: (FDDCGKNEEFLNDRCDICPVYEESDEDDQK); molecular weight 3572.
[0126] SEQ ID NO: 7: (GKSNSRNDEMLDPEASFWGEEKRASHTTPV); molecular weight 3413
[0127] SEQ ID NO: 8: (QEKEKEEVKEKEEVKEKEEVKEKEEVKEKE); the molecular weight is 3376. SEQ ID NO: 9: (PKDQLDYENDIEKKICKMEK); molecular weight 2469.
[0128] SEQ ID NO: 10: (KAEPKNPRENKLKQPGDRAD); molecular weight 2291.
[01...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com
