A molecular brake that quickly terminates the killing effect of CAR-T cells and its use
A technology of cell and intracellular signaling, applied in the fields of immunology and cell biology
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0082] Example 1: Design of CD19-specific CAR containing CD20 molecular brake and construction of expression vector
[0083] According to the different insertion positions of the CD20 molecular brake, 10 types of CD19-specific CARs were designed and constructed (see figure 1 ), were spliced into the entire fused amino acid sequence and the coding DNA expression frame, and were named CAR1920-1, CAR1920-2, CAR1920-3, CAR1920-4, CAR1920-5, CAR1920-6, CAR1920-7, CAR1920-8, CAR1920- 9. CAR1920-10. in:
[0084] The amino acid residue sequence of CAR1920-1 is: (546aa)
[0085] MALPVTALLLPLALLLHAARPS GGGGGGGGG DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEIT EVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSAAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADA...
Embodiment 2
[0147] Example 2: Genetic modification of T cells
[0148] Prepare 1×10 7 Peripheral blood mononuclear cells (PBMC) obtained by fresh isolation, respectively, 6 μg of the pNB328-CAR1920-1, pNB328-CAR1920-2, pNB328-CAR1920 -3, the pNB328-CAR1920-4 plasmid was transfected into the nucleus, and placed at 37°C, 5% CO 2 Culture in an incubator; transfer to a 6-well plate containing 30ng / mL anti-CD3 antibody and 3000IU / mL IL-2 (purchased from Novoprotein Company) after 6 hours, and place at 37°C, 5% CO 2 Incubator culture. After the cells were confluent, they were subcultured at a ratio of 1:5. After 3 passages, the proportion of CAR-positive cells was detected by flow cytometry (goat anti-mouse Fab2' antibody, purchased from Jackson, USA).
Embodiment 3
[0150] Example 3: In vitro brake function detection of CAR19-T cells containing CD20 molecular brake
[0151] 1. Construction of HEK293 cells (target cells) stably expressing CD19 gene
[0152] 1) According to the DNA coding sequence of the extracellular region and transmembrane region of CD19, Shanghai Jereh Biotechnology Co., Ltd. was commissioned to synthesize the whole gene and insert it into the pNB328 vector. The constructed vector was named pNB328-CD19.
[0153] The coding sequence of CD19 extracellular region and transmembrane region is as follows: (960bp)
[0154] ATGCCACCTCCTCGCCTCCTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGGGAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCCCTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCCCCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAATGTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGA...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap