Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A molecular brake that quickly terminates the killing effect of CAR-T cells and its use

A technology of cell and intracellular signaling, applied in the fields of immunology and cell biology

Active Publication Date: 2019-02-01
SHANGHAI CELL THERAPY RES INST +2
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0009] However, the cytokine "cascade" effect caused by off-target CAR-T cells is very fast, and these suicide systems may not be able to function in time

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A molecular brake that quickly terminates the killing effect of CAR-T cells and its use
  • A molecular brake that quickly terminates the killing effect of CAR-T cells and its use
  • A molecular brake that quickly terminates the killing effect of CAR-T cells and its use

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0082] Example 1: Design of CD19-specific CAR containing CD20 molecular brake and construction of expression vector

[0083] According to the different insertion positions of the CD20 molecular brake, 10 types of CD19-specific CARs were designed and constructed (see figure 1 ), were spliced ​​into the entire fused amino acid sequence and the coding DNA expression frame, and were named CAR1920-1, CAR1920-2, CAR1920-3, CAR1920-4, CAR1920-5, CAR1920-6, CAR1920-7, CAR1920-8, CAR1920- 9. CAR1920-10. in:

[0084] The amino acid residue sequence of CAR1920-1 is: (546aa)

[0085] MALPVTALLLPLALLLHAARPS GGGGGGGGG DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEIT EVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSAAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADA...

Embodiment 2

[0147] Example 2: Genetic modification of T cells

[0148] Prepare 1×10 7 Peripheral blood mononuclear cells (PBMC) obtained by fresh isolation, respectively, 6 μg of the pNB328-CAR1920-1, pNB328-CAR1920-2, pNB328-CAR1920 -3, the pNB328-CAR1920-4 plasmid was transfected into the nucleus, and placed at 37°C, 5% CO 2 Culture in an incubator; transfer to a 6-well plate containing 30ng / mL anti-CD3 antibody and 3000IU / mL IL-2 (purchased from Novoprotein Company) after 6 hours, and place at 37°C, 5% CO 2 Incubator culture. After the cells were confluent, they were subcultured at a ratio of 1:5. After 3 passages, the proportion of CAR-positive cells was detected by flow cytometry (goat anti-mouse Fab2' antibody, purchased from Jackson, USA).

Embodiment 3

[0150] Example 3: In vitro brake function detection of CAR19-T cells containing CD20 molecular brake

[0151] 1. Construction of HEK293 cells (target cells) stably expressing CD19 gene

[0152] 1) According to the DNA coding sequence of the extracellular region and transmembrane region of CD19, Shanghai Jereh Biotechnology Co., Ltd. was commissioned to synthesize the whole gene and insert it into the pNB328 vector. The constructed vector was named pNB328-CD19.

[0153] The coding sequence of CD19 extracellular region and transmembrane region is as follows: (960bp)

[0154] ATGCCACCTCCTCGCCTCCTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGGGAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCCCTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCCCCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAATGTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGA...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the fields of immunology and cytobiology and relates to a molecular brake for rapidly stopping the killing effect of CAR-T (T cell engineered with chimeric antigen receptors) and an application of the molecular brake. Specifically, the molecular brake serving as an element is inserted into the specific position in the CAR and can rapidly stop the killing effect of the CAR-T on a target cell, thereby effectively improving the safety of CAR-T treatment. The invention further relates to immunoreactive cells expressing the CAR and an application of the immunoreactive cells in preparation of drugs for treating malignant tumors or virus infectious diseases.

Description

technical field [0001] The invention belongs to the field of immunology and cell biology, and relates to a molecular brake for quickly stopping the killing effect of CAR-T cells and its application. Specifically, the molecular brake is inserted as a component into a specific position inside chimeric antigen receptors (chimeric antigen receptors, CAR), which can quickly stop the killing effect of chimeric antigen receptor-modified T cells on target cells. The present invention also relates to the use of the CAR-T cells expressing the molecular brake for the medicine of malignant tumors and viral infectious diseases. Background technique [0002] Chimeric antigen receptor engineering T cells (chimeric antigen receptor engineering T cells, referred to as CAR-T cells) have achieved great success in the treatment of refractory B cell malignancies, with a complete remission rate of 90%; in other solid tumors It also shows good application prospects in the treatment of . However,...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K19/00C12N15/62C12N15/85C12N5/10A61K35/17A61P35/00A61P31/12G01N33/68
Inventor 钱其军金华君李林芳叶真龙胥阶英吕赛群吴红平吴孟超
Owner SHANGHAI CELL THERAPY RES INST
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com