Genetic variants associated with lithium response in bipolar disorder
A bipolar, emotional technology, applied in the direction of biochemical equipment and methods, microbiological determination/inspection, inorganic active ingredients, etc., can solve problems such as no curative effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0009] The discovery of a correlation between genetic variants of glutamate decarboxylase-like 1 (GADL1) and lithium efficacy in patients with bipolar disorder was unexpected. Patients with one or more variants of the GADL1 gene were more likely to respond to lithium therapy.
[0010] GADL1 belongs to the second group of decarboxylase (decarboxylase) family, such as the position of the genome (chromosome No. 3), genomic DNA sequence (see, for example, NC_000003.11ReferenceGRCh37.p13PrimaryAssembly, chr3:30767692-30936153), cDNA sequence (see AccessionNo.NM_207359.2) and human GADL1 protein sequence (see eg AccessionNo.NP_997242.2).
[0011] The amino acid sequence of an exemplary GADL1 polypeptide and the cDNA sequence encoding the polypeptide are shown below.
[0012] Human GADL1 amino acid sequence (SEQ ID NO: 1):
[0013] MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEVVLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQLYAGLDYYSLVARFMTEALNPSVYTYEVSPVF...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 