Kits that can be used to aid in the diagnosis of malaria
A kit, malaria technology, applied in biological testing, resistance to vector-borne diseases, material testing products, etc., can solve problems such as limiting the rapid and effective diagnosis of malaria
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment
[0123] 1. Preparation and Confirmation of Peptides
[0124] The polypeptides used in the examples were synthesized by Jill Biochemical (Shanghai) Co., Ltd. and confirmed by mass spectrometry. in,
[0125] SEQ ID NO: 1: (SEIILPENVETEEIIDDVPSPKHSNHETFE); molecular weight 3449.
[0126] SEQ ID NO: 2: (NDFSEYHEDINDINFKK); molecular weight 2128.
[0127] SEQ ID NO: 3: (GESKETGESKETGESKETGESKETGESKET); molecular weight 3176.
[0128] SEQ ID NO: 4: (AGKKIDKKKEQANKKNNNNNKNKNKNKNKNLSK); molecular weight is (3468).
[0129] SEQ ID NO: 5: (IVPEQNDEESGESGLVDNEEGDFEEPNHEE); molecular weight 3373.
[0130] SEQ ID NO: 6: (EIKKQVEEGIKEENDTEGNDKVKGPEIITEE); molecular weight (3400).
[0131] SEQ ID NO: 7: (SFWGEEKRASHTTPVLMEKPYY); molecular weight 2657.
[0132] SEQ ID NO: 8: (AEKPYIIPTSNCSANDIVKYEHTLKTQITL); molecular weight 3392.
[0133] SEQ ID NO: 9: (KNDEQKDKVLGEGDKEDVKEKNDEQKDKVL); molecular weight 3502.
[0134] 2. Preparation of detection kit
PUM
Property | Measurement | Unit |
---|---|---|
diameter | aaaaa | aaaaa |
diameter | aaaaa | aaaaa |
diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com