Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Application of MMP9 inhibitor in preparation of medicine for preventing and/or treating colitis or colon cancer

An MMP9 and inhibitor technology, applied in the application field of MMP9 inhibitor in the preparation of colitis or colon cancer drugs, can solve the problem of no targeted and specific inhibitor and the like

Inactive Publication Date: 2021-12-10
SHENZHEN UNIV
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] The purpose of this application is to provide an application of MMP9 inhibitors in the preparation of colitis or colon cancer drugs, aiming to solve the problem that there is no inhibitor in the prior art that can target and specifically interact with MMP9 to prepare colitis or colon cancer Problems with Colon Cancer Drugs

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of MMP9 inhibitor in preparation of medicine for preventing and/or treating colitis or colon cancer
  • Application of MMP9 inhibitor in preparation of medicine for preventing and/or treating colitis or colon cancer
  • Application of MMP9 inhibitor in preparation of medicine for preventing and/or treating colitis or colon cancer

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0035] In some embodiments, the preparation method of MMP9 inhibitor comprises the following steps:

[0036] S01. Design the amino acid mutation sites of CDR1, CDR2 and CDR3 in the CDR region and synthesize the CDRs mutation primers through a large number of sequencing and comparative analysis of multiple natural libraries;

[0037] S02. Provide the synthesized Nanobody template sequence, perform codon optimization on the Nanobody template sequence and introduce a restriction enzyme cleavage site to obtain an optimized Nanobody template sequence;

[0038] S03. Insert the optimized nanobody template sequence into the phagemid carrier to construct a recombinant phagemid, perform phage display on the recombinant phagemid and extract single-stranded DNA, and use the Kunkel mutation method to pair CDRs mutation primers with single-stranded DNA to synthesize heterologous double-stranded DNA, and transformed into Escherichia coli to obtain a phage mutant library;

[0039] S04. Using...

Embodiment 1

[0076] Application of MMP9 inhibitor in the preparation of drugs for preventing and / or preventing and treating colitis or colon cancer

[0077] 其中,MMP9抑制剂选自G3CC,G3CC的氨基酸序列为SEQ.ID No.2为:MKKTAIAIAVALAGFATVAQAAQVQLQESGGGLVQAGGSLRLSCAASGNIFRYRSMGWYRQAPGKERELVAGISRGTTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVYRNQRVYGRGPVLRPLKYWGQGTQVTVSSGQAGQHHHHHHGAYPYDVPDYAS*。

[0078] The preparation method of MMP9 inhibitor comprises the steps:

[0079] (1) Design the amino acid mutation sites of CDR1, CDR2 and CDR3 in the CDR region and synthesize the CDRs mutation primers through a large number of sequencing and comparative analysis of multiple natural libraries; wherein, the mutation primers for CDR1 are as shown in SEQ.ID No.6 The mutation primer of CDR2 is shown in SEQ.ID No.7, and the mutation primer of CDR3 is shown in SEQ.ID No.8;

[0080] (2) Provide the synthesized Nanobody template sequence, perform codon optimization on the Nanobody template sequence and introduce a restriction endo...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to the technical field of biological medicines, and provides application of an MMP9 inhibitor in preparation of a medicine for preventing and / or treating colitis or colon cancer. Due to bloody stool and diarrhea accompanied by colitis, on one hand, body fluid loss of a patient is serious, and the body is weaker, and on the other hand, the treatment difficulty of the disease is further increased. The MMP9 inhibitor provided by the invention for the first time can effectively treat colitis and colon cancer related to colitis, and the MMP9 inhibitor is used for preparing the medicine for preventing and / or treating colitis or colon cancer, so that body fluid loss is reduced, the treatment period is shortened, the cure rate is improved, the MMP9 inhibitor has positive medication guiding significance, and the application value of the MMP9 inhibitor is improved.

Description

technical field [0001] The application belongs to the technical field of biomedicine, and in particular relates to the application of an MMP9 inhibitor in the preparation of colitis or colon cancer drugs. Background technique [0002] Inflammatory bowel disease (Inflammatory Bowel Disease, IBD), including ulcerative colitis (Ulcerative colitis, UC) and Crohn's disease (Crohn's disease, CD), is a chronic relapsing autoimmune disease. While the average prevalence of IBD is estimated to be 1 in 1,000 in Western countries, the incidence of the disease is rising globally, although the number is lower in developing countries. The clinical manifestations of IBD are abdominal pain, diarrhea, rectal bleeding, and fever; ulcerative colitis is characterized by persistent inflammation of the rectum and proximal colon, crypt abscesses and mucosal ulcers caused by neutrophil infiltration; Crohn's disease can Intermittently affects any part of the gastrointestinal tract, most commonly the...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A61K39/395C07K16/40C12N15/13C12N15/70A61P1/00A61P35/00A61P29/00
CPCC07K16/40C07K16/005C12N15/70A61P1/00A61P35/00A61P29/00C07K2317/565C07K2317/569C12N2800/22C12N2800/101A61K2039/505
Inventor 叶亮吴丹丹郑厚胜
Owner SHENZHEN UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com