A kind of human insulin analogue precursor and preparation method thereof
A technology for human insulin and analogues, applied in the fields of biochemistry and molecular biology, which can solve the problems of cumbersome process and low yield
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0051] Example 1: Construction of recombinant yeast expression systems analogue of human insulin precursor
[0052] For two steps as follows
[0053] (1), recombinant human insulin analogue precursor Expression Vector
[0054] Recombinant human insulin C-peptide analogs of the precursor with different spacer peptide corresponding to a different gene sequence.
[0055] Amino acid sequence
[0056] EEGEPKFVNQHLCGSHLVEALYLVCGERGFFYTDKERWRGIVEQCCTSICSLYQLENYCN (SEQ IDNO.8)
[0057] Corresponding to the following nucleotide sequence, they are in italics EcoRI and NotI restriction sites.
[0058] GAAGAAGGTGAACCAAAGTTCGTCAACCAGCACTTGTGTGGTTCCCATTTGGTTGAGGCTCTGTACTTGGTCTGTGGAGAAAGAGGTTTCTTTTACACCGATAAGGAAAGATGGAGAGGTATCGTTGAGCAATGTTGCACCTCTATTTGTTCCCTGTATCAGTTGGAAAACTACTGCAACTAAGCGGCCGC (SEQ ID NO.24)
[0059] Amino acid sequence EEGEPKFVNQHLCGSHLVEALYLVCGERGFFYTDKEKFRKGIVEQCCTSICSLYQLENYCN (SEQ ID NO.12)
[0060] Corresponding to the following nucleotide sequence, they are in italics E...
Embodiment 2
[0076] Example 2: High molecular weight determination and expression screening recombinant strains
[0077] (1) Yeastern blot expression screening
[0078] Each recombinant strain selected from different Zeocin concentrations of each monoclonal plate 80, a total of about 400, Yeastern blot for expression screening.
[0079] Yeastern blot can quickly detect the expression of large quantities of proinsulin colonies. To do is picked from the various concentrations of Zeocin plates containing the corresponding monoclonal streaked YPD Zeocin plates concentration, 30 ℃ culture incubator for 1-2 days until colonies full length. Cells by replica-plated to a method sterilized bacterial cellulose nitrate (Nitrocellulose, NC) membrane, the NC membrane printed with colonies attached BMMY placed on plates covered with methanol saturated placed WHATMAN NO. the cover plate 1 filter paper, at 30 deg.] C incubator for 2 days induced inversion. Detected by Western blot for each monoclonal proinsuli...
Embodiment 3
[0088] 5L insulin analogue precursor fermentation: Example 3
[0089] The Production Example 5L fermentation yeast Pichia as a host strain of the insulin analogue precursor EEGEPK-B (1-27) -DKE-RWER-A (1-21) (SEQ ID NO.13) as an example, the present invention the other insulin analogue precursor can be obtained by the fermentation method.
[0090] Minutes following four steps.
[0091] (1) to take 0.2ml glycerol was inoculated with 200ml YPG medium (yeast extract 10g / L, soy peptone 20g / L, glycerol, 20g / L) in 1L shake flasks at 30 ℃ 250rpm shaking for about 22h, strains were grown to an OD600 of about 12.
[0092] (2) good seed culture was inoculated into 5L fermenter for fermentation, using 2.5L BSM medium (which component: 85% phosphoric acid 26.7ml / L, CaSO 4 · 2h 2 O 1.2g / L, K 2 SO 4 18.2g / L, MgSO 4 7.3g / L, KOH 4.1g / L, Glycerol 40.0g / L, PTM1 4.4ml / L, 25% aqueous ammonia to adjust the pH 5.5. PTM1: CuSO 4 · 5h 2 O, 6.0g / L; KI, 0.08g / L; MnSO 4 · H 2 O, 3.0g...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


