A kind of anticancer bioactive peptide cb1a and its application
A technology of biologically active peptides and drugs, applied in the field of biomedicine, can solve the problems of large body damage and prone to postoperative inflammatory reactions, and achieve low toxicity and good anti-cancer effects
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0024] First, the synthesis and formulation of CB1A polypeptides
[0025] (1) CB1A polypeptide is synthesized by Strong Yao Biological Polypeptide Co., Ltd., and its amino acid sequence is as follows: KWKVFKKIEK-KWKVFKKIEK-AGP-KWKVFKKIEK-NH 2 . Amino Acid Sequences of Enemy B (CB): kwkvfkiekmgrnirngivkagpaiavlgeakal. The CB1A polypeptide has 33 amino acids and net +12 valeries, and the CB N-terminal original 10 amino acid KWKVFKKIEK is repeated 3 times, and the conservative hinge sequence AGP is constructed between the Tianswormin between the second and third repetitions. become. KWKVFKKIEK is the gender α-spiral, one end hydrophilic, one end of the hydrophobic; AGP is a hinge bridge that connects two spirals. The proline residue in the Covery acts on the ion channel gating and oligomerization of the peptide. The oligomer of CB1A affects its anti-cancer effect. Secondary structural diagram of CB1A polypeptide in a membrane environment figure 1 As shown, the CB1a forms a helical-hi...
Embodiment 2
[0070] I. Cultivation and treatment of LN-229 cells
[0071] The human glue tumor cell LN-229 was cultured with a DMEM medium (containing 10% FBS), and the subsequent treatment was cultured and treated with the A549 cells of Example 1.
[0072] Second, Vital Detection of LN-229 Cells
[0073] Steps to detect the vitality detection of A549 cells in Example 1, Figure 8 The inhibitory effect of CB1A on the proliferation of cancer cells LN-229 is stronger than CB.
Embodiment 3
[0075] I. Cultivation and treatment of HepG2 cells
[0076] The specific steps were cultured and treated with the A549 cells of Example 1.
[0077] Second, the vitality detection of HepG2 cells
[0078] Steps to detect the vitality detection of A549 cells in Example 1, Figure 9 The CB1A is inhibited to inhibit the proliferation of cancer cells HepG2 in CB.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


