Unlock instant, AI-driven research and patent intelligence for your innovation.

A kind of anticancer bioactive peptide cb1a and its application

A technology of biologically active peptides and drugs, applied in the field of biomedicine, can solve the problems of large body damage and prone to postoperative inflammatory reactions, and achieve low toxicity and good anti-cancer effects

Inactive Publication Date: 2021-10-26
WUHAN POLYTECHNIC UNIVERSITY
View PDF5 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0002] Since the current methods of treating cancer cause great damage to the body and are prone to postoperative inflammatory reactions, finding highly efficient and low-toxic anticancer drugs has always been one of the current research hotspots worldwide.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of anticancer bioactive peptide cb1a and its application
  • A kind of anticancer bioactive peptide cb1a and its application
  • A kind of anticancer bioactive peptide cb1a and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0024] First, the synthesis and formulation of CB1A polypeptides

[0025] (1) CB1A polypeptide is synthesized by Strong Yao Biological Polypeptide Co., Ltd., and its amino acid sequence is as follows: KWKVFKKIEK-KWKVFKKIEK-AGP-KWKVFKKIEK-NH 2 . Amino Acid Sequences of Enemy B (CB): kwkvfkiekmgrnirngivkagpaiavlgeakal. The CB1A polypeptide has 33 amino acids and net +12 valeries, and the CB N-terminal original 10 amino acid KWKVFKKIEK is repeated 3 times, and the conservative hinge sequence AGP is constructed between the Tianswormin between the second and third repetitions. become. KWKVFKKIEK is the gender α-spiral, one end hydrophilic, one end of the hydrophobic; AGP is a hinge bridge that connects two spirals. The proline residue in the Covery acts on the ion channel gating and oligomerization of the peptide. The oligomer of CB1A affects its anti-cancer effect. Secondary structural diagram of CB1A polypeptide in a membrane environment figure 1 As shown, the CB1a forms a helical-hi...

Embodiment 2

[0070] I. Cultivation and treatment of LN-229 cells

[0071] The human glue tumor cell LN-229 was cultured with a DMEM medium (containing 10% FBS), and the subsequent treatment was cultured and treated with the A549 cells of Example 1.

[0072] Second, Vital Detection of LN-229 Cells

[0073] Steps to detect the vitality detection of A549 cells in Example 1, Figure 8 The inhibitory effect of CB1A on the proliferation of cancer cells LN-229 is stronger than CB.

Embodiment 3

[0075] I. Cultivation and treatment of HepG2 cells

[0076] The specific steps were cultured and treated with the A549 cells of Example 1.

[0077] Second, the vitality detection of HepG2 cells

[0078] Steps to detect the vitality detection of A549 cells in Example 1, Figure 9 The CB1A is inhibited to inhibit the proliferation of cancer cells HepG2 in CB.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an anticancer bioactive peptide CB1a and its application, belonging to the technical field of biomedicine. The anti-cancer bioactive peptide CB1a is transformed from cecropin B, and its amino acid sequence is shown in SEQ ID NO.1. It has a certain inhibitory effect on the proliferation of lung cancer cells, human glioma cells, liver cancer cells, etc. CB1a polypeptide It can also make cancer cells in the quiescent stage of growth, induce late apoptosis and inhibit migration. The CB1a polypeptide can be used to prepare anticancer drugs, and its anticancer effect is better than that of cecropin B. The invention lays a good foundation for the development of anticancer polypeptide drugs and the research of anticancer mechanism.

Description

Technical field [0001] The invention belongs to the field of biomedicine technology, and is specifically involved in an anti-cancer bioactive peptide CB1a and its application thereof. Background technique [0002] Since the current treatment of cancer has a large damage caused by the body, and it is prone to the postoperative inflammatory response, it is a high-efficiency and low-toxic anticancer drug that has always been one of the current world research hotspots. In recent years, a batch of biological polypeptides such as frogs such as frogs such as frogs, bee toxins, leopases are found in recent years. Polypeptide drugs, especially anti-cancer peptides, due to the characteristics of small molecular weight, high targeting, low toxicity, etc., have important research value and prospects in cancer clinical treatment. Inventive content [0003] It is an object of the present invention to provide an anti-cancer bioactive peptide CB1a having low toxicity, strong, non-to-formation r...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/00A61K38/16A61P35/00
CPCA61K38/00A61P35/00C07K14/00
Inventor 张军林解举民赖晓晶程烨岳硕豪
Owner WUHAN POLYTECHNIC UNIVERSITY