Supercharge Your Innovation With Domain-Expert AI Agents!

Chimeric antigen receptor based on CD276 antibody, lentivirus expression vector and application thereof

A chimeric antigen receptor, CD276 technology, applied in the application, hybrid peptide, genetic engineering and other directions, can solve the problem of unclear the best therapeutic effect of scFv, and achieve the improvement of T cell function, lasting killing ability and effect improvement. Effect

Inactive Publication Date: 2019-06-25
THE FIRST AFFILIATED HOSPITAL OF ZHENGZHOU UNIV
View PDF6 Cites 19 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

This patented technology allows researchers to study how an individual's own cancer has developed overtime by studying different factors like its growth rate, type of disease being treated, etc., resulting from this process called cytotoxic chemotherapies used during surgery on patients with advanced lung cancer who were previously untreated. These treatments aim at reducing their chances of developing new metastases later when they become symptomatic again after having been removed through surgery procedures. To achieve these technical benefits, it suggests introducing specific molecules into certain areas within the body where CAR -cell therapy targets may already exist.

Problems solved by technology

This patented technical problem addressed by the patents relates to finding ways to enhance or optimize how well immune system components work against cancer through gene editing techniques such as CRISPRs.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Chimeric antigen receptor based on CD276 antibody, lentivirus expression vector and application thereof
  • Chimeric antigen receptor based on CD276 antibody, lentivirus expression vector and application thereof
  • Chimeric antigen receptor based on CD276 antibody, lentivirus expression vector and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0039] 1. CAR Structure

[0040] 1. CD276-28z-CAR structure

[0041] Such as figure 1 As shown, the basic structure of CAR includes: human CD8a molecule signal peptide (Leading signal), CD276 single-chain antibody (scFv), human CD8a molecule flexible fragment (CD8Hinge), human CD28 molecule transmembrane region and intracellular region (CD28), human CD3z Molecular intracellular domain (CD3z). The amino acid sequence of the CD276-28z-CAR structure is shown in SEQ ID NO.1.

[0042] Wherein, the amino acid sequence of the signal peptide (SP) sequence is:

[0043] MALPVTALLLPLALLLHAARPGS (SEQ ID NO. 4).

[0044] Affinity-enhanced CD276 single-chain antibody (CD276-scFv) sequence:

[0045] QVQLVQSGAEVVKPGASVKLSCKTSGYTFTNYDINWVRQRPGQGLEWIGWIFPGDGSTQYNEKFKGKATLTTDTSTSTAYMELSSLRSEDTAVYFCARQTTATWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVMTQSPATLSVSPGERVTLSCRASQSISDYLYWYQQKSHESPRLLIKYASQSISGIPARFSGSGSGSEFTLTINSVEPEDVGVYYCQNGHSFPLTFGQGTKLELKR(SEQ ID NO.5)。

[0046] Flexible fragment and tran...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of biology and particularly relates to a chimeric antigen receptor based on a CD276 antibody, a lentivirus expression vector and application thereof. The chimeric antigen receptor is CD276-28z-CAR chimeric antigen receptor, a CD276-BBz-CAR or CD276-28BBz-CAR chimeric antigen receptor, the amino acid sequence of the CD276-28z-CAR chimeric antigen receptor is shown in SEQ ID NO.1, the amino acid sequence of the CD276-BBz-CAR chimeric antigen receptor is shown in SEQ ID NO.2, and the amino acid sequence of the CD276-28BBz-CAR chimeric antigen receptoris shown in SEQ ID NO.3. The chimeric antigen receptor is constructed by adopting an scFv sequence with higher affinity, so that generated CAR-T cells can effectively kill tumor cells.

Description

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Owner THE FIRST AFFILIATED HOSPITAL OF ZHENGZHOU UNIV
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More