Anti-il1rap antibodies and methods of use thereof

An antibody, HVR-L1 technology, applied in chemical instruments and methods, antibodies, anti-inflammatory agents, etc., can solve the problem of lack of inhibitory effect on signal transduction

Pending Publication Date: 2021-05-25
23和我公司
View PDF78 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

CAN03 has been established to have some inhibitory effects on signaling stimulated by IL-1α, IL-1β and

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Anti-il1rap antibodies and methods of use thereof
  • Anti-il1rap antibodies and methods of use thereof
  • Anti-il1rap antibodies and methods of use thereof

Examples

Experimental program
Comparison scheme
Effect test

example

[0311] Various features and embodiments of the present disclosure are described in the following representative examples, which are intended to be illustrative and not restrictive. Those skilled in the art will readily appreciate that these specific examples are merely illustrative of the invention, as more fully described in the claims that follow. Each embodiment and feature described in this application should be understood to be interchangeable and combinable with each embodiment contained therein.

example 1

[0312] Example 1: Production of IL1RAP polypeptide

[0313] This example illustrates the preparation of various IL1RAP polypeptide constructs for use as antigens to elicit and screen the anti-IL1RAP antibodies of the present disclosure.

[0314] Based on structural information in Wang et al., Nature Immunology, 11:905-912 (2010), the extracellular domain of hu-IL1RAP was recombinantly purified to full-length and individual domains (ie, D1 , D2, D3). Amino acid sequence boundaries for the expression constructs are provided in Table 1 above and the accompanying Sequence Listing. All recombinant IL1RAP polypeptide constructs have the following "GGGS-V5-6XHis" C-terminal tag for purification and detection: GGGSGKPIPNPLLGLDSTHHHHHH (SEQ ID NO: 319). For purification and detection, the individual domain constructs (eg D1, D1D2, D3) have the following "GGGS-V5-Avi-6XHis" C-terminal tag (also "Avi" tag): GGGSGKPIPNPLLGLDSTGLNDIFEAQKIEWHEHHHHHH (SEQ ID NO: 320 ).

[0315] The IL1RA...

example 2

[0316] Example 2: Generation of anti-human IL1RAP antibodies using hybridoma method, screening and selection for further characterization.

[0317] This example illustrates methods for producing anti-hu-IL1RAP antibodies using mouse hybridoma technology and methods for screening and selecting antibodies for further characterization.

[0318] Immunization and fusion : Balb / c, Swiss Webster and SJ / were immunized with the hu-M-IL1RAP polypeptide construct of SEQ ID NO: 3 (see Table 1 ) comprising the membrane-formed extracellular domain of hu-IL1RAP using 50 μg / mouse L mice. Following the primary immunization, subsequent booster immunizations were administered with the following 3 different IL1RAP immunogens at the schedule and duration required to induce appropriate titers of anti-IL1RAP antibodies in mice: SEQ ID NO: 3 at 25 μg / mouse (hu-M-IL1RAP), 25 μg / mouse of SEQ ID NO:9 (mo-M-IL1RAP), or 25 μg / mouse of SEQ ID NO:6 (hu-M-IL1RAP-D3) peptide. Adjuvant Magic Mouse (Creat...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

PropertyMeasurementUnit
Concentrationaaaaaaaaaa
Login to view more

Abstract

The present invention provides binding proteins, such as antibodies and antigen-binding fragments, which specifically bind to human interleukin-1 receptor accessory protein (hu-IL1RAP) and fully block the IL-1, IL-33, and IL-36 intracellular signaling pathways. Compositions comprising such binding proteins and methods of making and using such binding proteins are also provided.

Description

[0001] cross reference [0002] This application claims priority to US Provisional Patent Application No. 62 / 719,397, filed August 17, 2018, which is hereby incorporated by reference for all purposes. technical field [0003] The present disclosure generally relates to binding proteins (eg, antibodies and antigen-binding fragments) that bind to interleukin-1 receptor accessory proteins, and methods of using such binding proteins. [0004] Sequence Listing Reference [0005] An official copy of the sequence listing is submitted concurrently with the specification via EFS-Web as a text file in ASCII format, named "09402-002US1_SeqListing_ST25.txt", dated August 15, 2019, and 180,889 bytes in size. The Sequence Listing submitted via EFS-Web is part of the specification and is incorporated herein by reference in its entirety. Background technique [0006] The interleukin-1 (IL-1) family of cytokine ligands and receptors is associated with inflammation, autoimmunity, immune ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
IPC IPC(8): A61P29/00A61P35/00A61P37/00C07K16/28A61K39/395
CPCC07K16/2866A61K2039/505C07K2317/76C07K2317/24C07K2317/92C07K2317/33C07K2317/565C07K2317/56A61P35/00A61P29/00A61P37/00A61P11/06A61P37/08C07K2317/30C07K2317/71C07K2317/75C12N5/16
Inventor D·福莱蒂E·卡勒G·福凯利K·伊巴拉郑泉黄耀民L·戴斯C·沃拉克D·S·本斯
Owner 23和我公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap