Unlock instant, AI-driven research and patent intelligence for your innovation.

Hdm-2 targeting compositions cause tumor cell necrosis rather than apoptosis of cancer cells

a technology of hdm2 and composition, which is applied in the direction of peptide sources, p53 proteins, instruments, etc., can solve the problems of limited p53-targeting cancer treatments and ineffective p53-targeting cancer treatments at treating various types of cancer

Inactive Publication Date: 2020-01-02
THE RES FOUND OF STATE UNIV OF NEW YORK
View PDF9 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The HDM-2 targeting compounds selectively induce necrosis in cancer cells, effectively treating various types of cancer, including those without functional p53, while sparing normal cells, thus offering a broader and more effective cancer treatment option.

Problems solved by technology

Thus, these p53 targeting cancer treatments are limited since they do not cause cell death in these types of cancer cells.
Thus, p53-targeting cancer treatments are ineffective at treating various types of cancer.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Hdm-2 targeting compositions cause tumor cell necrosis rather than apoptosis of cancer cells
  • Hdm-2 targeting compositions cause tumor cell necrosis rather than apoptosis of cancer cells
  • Hdm-2 targeting compositions cause tumor cell necrosis rather than apoptosis of cancer cells

Examples

Experimental program
Comparison scheme
Effect test

examples

Materials and Methods

[0143]Peptides.

[0144]The following peptides were synthesized by solid phase methods and were purified to >95% purity (Biopeptides Corp, La Jolla, Calif.): PNC-27 containing residues 12-26 (PPLSQETFSDLWKLL) (SEQ ID NO: 8) from the hdm-2 binding domain of p53 and PNC-28 (ETFSDLWKLL) (SEQ ID NO: 32) containing residues 17-26 from the hdm-2 binding domain of p53, both attached on their carboxyl terminal ends to the transmembrane-penetrating sequence which is related to the reverseomer sequence of the antennapedia sequence, KKWKMRRNQFWVKVQRG (SEQ ID NO: 1), also called MRP; the control peptide PNC-26, containing only residues 12-26 of p53 and no MRP; the control peptide PNC-29, an unrelated peptide from cytochrome P450 (also called X13) (bold) attached to MRP (italics), whose sequence is MPFSTGKRIMLGEKKWKMRRNQFWVKVQRG (SEQ ID NO: 4); and PNC-7, a peptide from the ras-p21 protein containing ras-p21 residues 35-47 (TIEDSYRKQVVID) (SEQ ID NO: 7) attached to the MRP havi...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
ODaaaaaaaaaa
ODaaaaaaaaaa
ODaaaaaaaaaa
Login to View More

Abstract

An aspect of the invention provides a method of selectively necrosing cells, comprising: providing a plurality cells, including at least one cancer cell and at least one non-cancerous cell; and administering to the cells a compound, including an HDM-2 targeting component and a cytotoxic component attached to the HDM-2 targeting component, wherein said compound comprises a membrane-active form.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS[0001]This patent application is a continuation of U.S. patent application Ser. No. 14 / 470,488, filed Aug. 27, 2014, which is a continuation of U.S. patent application Ser. No. 13 / 122,256, filed Sep. 14, 2011, which is the national stage filing of International Patent Application No. PCT / US2009 / 059380, filed Oct. 2, 2009, which claims the benefit of and priority to U.S. Provisional Patent Application Ser. No. 61 / 102,590 filed on Oct. 3, 2008, the contents of which are incorporated herein by reference in their entirety.FUNDING STATEMENT[0002]This invention was made with government support by a Veteran's Administration Grant (WBB) and The American College of Surgeon's Faculty Research Fellowship Award 2007-2009 (WBB).FIELD OF THE INVENTION[0003]The invention relates to methods of effectively treating various forms of cancer and screening candidate cancer treatments and compounds. Specifically, the present invention is directed to the use of novel...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): C07K14/47G01N33/50G01N33/574
CPCC07K14/4746G01N2333/904G01N2500/10G01N33/57484G01N2333/4748G01N33/5011A61K45/06G01N33/57407G01N33/57492A61P35/00A61K38/02C07K2/00
Inventor PINCUS, MATTHEW R.MICHL, JOSEFSARAFRAZ-YAZDI, EHSAN
Owner THE RES FOUND OF STATE UNIV OF NEW YORK