A kind of Eucheuma extract and its application in preparation of medicine for treating organ fibrosis
A technology of organ fibrosis and kylin cabbage, which is applied in the directions of drug combination, drug delivery, pharmaceutical formulation, etc., can solve the problems of unreported peptide components of kylin cabbage, no discovery in literature, etc., and achieve the effect of significantly treating organ fibrosis.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0031] A kind of Eucheuma extract, its preparation method comprises the following steps:
[0032] 1) Wash Eucheuma;
[0033] 2) Take 100g of the Eucheuma treated in step 1), add 1000g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and ultrafiltration with an ultrafiltration membrane system, 0.1 A microporous membrane with a molecular weight cut-off of 5000 Daltons and an operating pressure difference of 0.1-0.5 MPa to obtain Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 3500 rpm per minute, the centrifugation time is 10 minutes. High pressure steam sterilization control parameters are as follows: 0.6 kg / cm 2 Sterilize under pressure (110°C) for 10 minutes; the gauze is medical gauze with 2mmX1mm holes.
Embodiment 2
[0035] A kind of Eucheuma extract, its preparation method comprises the following steps:
[0036] 1) Wash Eucheuma;
[0037] 2) Take 100g of the Eucheuma treated in step 1), add 800g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and use an ultrafiltration membrane system for ultrafiltration, 0.1 micron microporous membrane, the molecular weight cut-off is 5000 Daltons, and the operating pressure difference is 0.1-0.5MPa to obtain the Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 3000 rpm per minute, the centrifugation time is 8 minutes. Others are the same as in Example 1.
Embodiment 3
[0039] A kind of Eucheuma extract, its preparation method comprises the following steps:
[0040] 1) Wash Eucheuma;
[0041] 2) Take 100g of the Eucheuma treated in step 1), add 1200g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and use an ultrafiltration membrane system for ultrafiltration, 0.1 micron microporous membrane, the molecular weight cut-off is 5000 Daltons, and the operating pressure difference is 0.1-0.5MPa to obtain the Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 4000 rpm per minute, the centrifugation time is 12 minutes. Others are the same as in Example 1.
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com