Antibodies that bind il-18 and methods of inhibiting il-18 activity

a technology of il-18 and antibodies, which is applied in the direction of depsipeptides, peptide/protein ingredients, fungi, etc., can solve the problems of eliciting unwanted immune reactions, antibody use limitations, and antibody description

Inactive Publication Date: 2011-01-13
ABBOTT LAB INC
View PDF100 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The fully human antibodies effectively neutralize IL-18 activity, providing a therapeutic option for IL-18-related disorders without inducing immune reactions, offering prolonged efficacy and specificity.

Problems solved by technology

Moreover, murine IL-18 antibodies are limited for their use in vivo due to problems associated with administration of mouse antibodies to humans, such as short serum half life, an inability to trigger certain human effector functions and elicitation of an unwanted immune response against the mouse antibody in a human (the “human anti-mouse antibody” (HAMA) reaction).
However, because these chimeric and humanized antibodies still retain some murine sequences, they still may elicit an unwanted immune reaction, the human anti-chimeric antibody (HAMA) reaction, especially when administered for prolonged periods.
However, such antibodies have not been described in the art and, therefore are still needed.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antibodies that bind il-18 and methods of inhibiting il-18 activity
  • Antibodies that bind il-18 and methods of inhibiting il-18 activity
  • Antibodies that bind il-18 and methods of inhibiting il-18 activity

Examples

Experimental program
Comparison scheme
Effect test

example 1

Isolation of Anti-IL-18 Antibodies

[0096]Antibodies to hIL-18 were isolated by screening separate scFv phage display libraries prepared using human VL and VH cDNAs from mRNA derived from human B cells (e.g., tonsils and spleen). Construction of the library and methods for selection are described in Vaughan et al. (1996) Nature Biotech. 14: 309-314.

[0097]The libraries were screened using either full length human IL-18 (SEQ ID NO: 61), a peptide epitope of IL-18 (SEQ ID NOS: 1-3), or a panel of overlapping 15 amino acid peptides representing IL-18 (the epitope sequence of which is presented in Table 5; SEQ ID NOS: 31-60). IL-18 specific antibodies were selected by coating the antigen onto immunotubes using standard procedures (Marks et al., (1991) J. Mol. Biol. 222: 581-597). The scFv libraries were screened using either IL-18, a peptide epitope of IL-18, or an IL-18 peptide panel to generate a significant number of IL-18 specific binders. Several different clonotypes were selected, de...

example 2

Affinity Maturation of an Anti-18 Antibodies

[0100]A single chain Fv version of antibody 2E1 having an identified IL-18 binding activity and the heavy chain and light chain sequence shown in Table 6 was further modified for improved neutralization of IL-18 activity.

TABLE 6Sequence of Single-Chain Anti-IL-18 Antibody 2E12E1 Heavy Chain(SEQ ID NO: 18)                             CDR1  (SEQ ID NO: 9)QVQLVQSGAEVKKPGASMKVSCKTSGYTFTGYYIHWVRQAHGQGFEWI      CDR2 (SEQ ID NO: 10)                        CDR3 (SEQ ID NO: 11)GRLNPTTGDANFAEKFQGRVALTRDTSISTAYLQLDSLKSDDTAVYYCAGKEGAWGQGTLVTVSS2E1 Light Chain(SEQ ID NO: 19)                        CDR1 (SEQ ID NO: 12)     CDR2 (SEQ ID NO: 13)SSELTQDPAVSVALGQTVRITCQGDSLRHFYPNWYQQKPGQAPVLVIYGKNNRPS                                    CDR3 (SEQ ID NO: 14)GIPDRFSGSGSGNTGSLTITGAQAEDEADYYCGSRDSSGIHVVFGGGTKVTVLG

[0101]The anti-IL-18 antibody 2E1 was independently selected using an IL-18 peptide and sequential, overlapping, peptide panel representative of IL-18 ...

example 3

Binding Activity of Human Antibodies to IL-18

[0110]Real-time binding interactions between ligand (biotinylated recombinant human IL-18 (rhIL-18) immobilized on a biosensor matrix) and analyte (antibodies in solution) were measured by surface plasmon resonance (SPR) using the BIAcore system (Pharmacia Biosensor, Piscataway, N.J.). The system utilizes the optical properties of SPR to detect alterations in protein concentrations within a dextran biosensor matrix. Proteins are covalently bound to the dextran matrix at known concentrations. Antibodies are injected through the dextran matrix and specific binding between injected antibodies and immobilized ligand results in an increased matrix protein concentration and resultant change in the SPR signal. These changes in SPR signal are recorded as resonance units (RU) and are displayed with respect to time along the y-axis of a sensorgram.

[0111]To facilitate immobilization of biotinylated rhIL-18 on the biosensor matrix, streptavidin is c...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

Antibodies that bind human interleukin-18 (hIL-18) are provided, in particular antibodies that bind epitope(s) of human IL-18. The antibodies can be, for example, entirely human antibodies, recombinant antibodies, or monoclonal antibodies. Preferred antibodies have high affinity for hIL-18 and neutralize hIL-18 activity in vitro and in vivo. An antibody of the invention can be a full-length antibody or an antigen-binding portion thereof. Method of making and method of using the antibodies of the invention are also provided. The antibodies, or antibody portions, of the invention are useful for detecting hIL-18 and for inhibiting hIL-18 activity, e.g., in a human subject suffering from a disorder in which hIL-18 activity is detrimental.

Description

RELATED APPLICATIONS[0001]This application is a continuation of, and claims priority from, U.S. patent application Ser. No. 09 / 780,035, filed on Feb. 9, 2001, entitled, “Antibodies that Bind IL-18 and Methods of Inhibiting IL-18 Activity,” which claims the benefit of U.S. Provisional Application No. 60 / 181,608, filed Feb. 10, 2000, entitled, “Antibodies that Bind Human Interleukin-18 and Methods of Making and Using,” the contents of each which are hereby incorporated by reference.BACKGROUND OF THE INVENTION[0002]Interleukin-18 (IL-18) was originally described in 1989 as interferon-gamma inducing factor (IGIF) and is a pro-inflammatory cytokine with various functions in addition to an ability to induce interferon gamma. These biological properties include activation of NF-κb, Fas ligand expression, the induction of both CC and CXC chemokines, and increased production of competent human immunodeficiency virus.[0003]Due to the ability of IL-18 to induce interferon gamma production in T...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(United States)
IPC IPC(8): A61K39/395C12P21/00C12N5/07C12N15/63C40B30/04C07K2/00C07K14/00C07K16/24C07H21/00A61P1/16A61P19/02A61P29/00A61P3/10A61P37/06A61P25/28A61P25/16A61P9/10A61P37/08A61P17/06A61P13/12A61P11/00A61P9/00A61P15/08A61P25/24A61P11/06A61P5/16A61P5/18A61P5/50A61K45/00C12N15/02A61P1/04A61P5/14A61P7/00A61P7/02A61P7/06A61P9/04A61P9/12A61P15/00A61P17/00A61P17/14A61P25/14A61P25/18A61P31/00A61P31/04A61P31/12A61P33/00A61P35/00A61P37/00A61P37/02A61P39/00A61P39/02C12N1/15C12N1/19C12N1/21C12N5/10C12P21/08
CPCC07K2316/96C07K2317/34C07K2317/565C07K2317/622C07K2317/92C07K2317/21A61K39/3955A61K38/13A61K31/56A61K31/519C07K16/244A61K2039/505A61K39/395A61K31/00C07K2317/76A61P1/00A61P1/04A61P1/16A61P11/00A61P11/06A61P13/00A61P13/12A61P15/00A61P15/08A61P15/10A61P17/00A61P17/06A61P17/14A61P19/00A61P19/02A61P19/04A61P19/06A61P21/00A61P25/00A61P25/08A61P25/14A61P25/16A61P25/18A61P25/24A61P25/28A61P27/02A61P29/00A61P3/00A61P31/00A61P31/04A61P31/10A61P31/12A61P31/14A61P31/18A61P33/00A61P35/00A61P3/08A61P37/00A61P37/02A61P37/06A61P37/08A61P39/00A61P39/02A61P43/00A61P5/00A61P5/14A61P5/16A61P5/18A61P5/40A61P5/50A61P7/00A61P7/02A61P7/04A61P7/06A61P9/00A61P9/04A61P9/10A61P9/12A61P3/10C07K16/24
InventorGHAYER, TARIQDIXON, RICHARD W.ROGUSKA, MICHAELWHITE, MICHAELLABKOVSKY, BORISSALFELD, JOCHENDUNCAN, ALEXANDER ROBERTBROCKLEHURST, SIMON MARKMANKOVICH, JOHNSHORROCK, CELIA PATRICIATHOMPSON, JULIA ELIZABETHLENNARD, SIMON NICHOLAS
OwnerABBOTT LAB INC