Method for Regulating Cell Proliferation

a cell proliferation and cell technology, applied in the field of cell proliferation regulation, can solve the problems of large amount of defective proteins produced, disrupted function of the er,

Inactive Publication Date: 2016-11-10
HIROSHIMA UNIVERSITY
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

When cells are exposed to an abnormal environment, the function of the ER may be disrupted and a large amount of defective proteins may be produced in the ER.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Method for Regulating Cell Proliferation
  • Method for Regulating Cell Proliferation
  • Method for Regulating Cell Proliferation

Examples

Experimental program
Comparison scheme
Effect test

example 1

Establishment of BBF2H7 Knockout Mouse

(1) Preparation of a Targeting Vector

[0155]A PCR (35 cycles of denature: 94° C. for 1 minute, annealing: 55° C. for 1 minute, and extension: 72° C. for 3 minutes) was performed with the genomic DNA from 129 mouse as a template and primers prepared based on the genomic sequence of the mouse BBF2H7 (ENSMUSG00000038648). DNA fragments of 1.5 kb (short arm) and 6 kb (long arm) around exon 2 of the BBF2H7 gene were isolated. The following primers were used:

for the short arm,(SEQ ID NO.: 5)5′-GCGGCCGCTTCGACACTTTGTCTGCCACTC-3′and(SEQ ID NO.: 6)5′-CTCGAGTCACTCCGAGAAGTGCTGCAAGAAGC-3′;for the long arm,(SEQ ID NO.: 7)5′-CAGAGATGCCCTGAGATCAGCTG-3′and(SEQ ID NO.: 8)5′-GGTACCCTACACCATGCGCCACCAGCCATG-3′.

[0156]The short and long arm DNA fragments were sequenced to confirm no nucleotide substitution was occurred.

[0157]Subsequently, the DNA fragments were inserted into the NotI-XhoI site (short arm) and the KpnI-KpnI site (long arm) of pPNT1.1 (Cell 1991 June 28,...

example 2

Proliferation of Primary Cultured Chondrocytes from the BBF2H7 Knockout Mouse

[0163]Primary cultured chondrocytes were derived from the wild-type (WT) mouse (C57BL / 6CR SLC mouse) and the Bbf2h7-deficient (Bbf2h7− / −) mouse (See Saito et al., Nat. Cell Biol. 2009, 11:1197-1204.). Proliferation of the cells was investigated with BrdU-incorporation assay. The assay revealed that BrdU-incorporation was significantly reduced in the Bbf2h7-deficient cells. This result indicates that the cell growth rate was reduced in the Bdf2h7-deficient cells (FIG. 5).

example 3

Generation of Anti-BBF2H7 Antibody

[0164]In order to generate an anti-human BB2H7 C terminus antibody, a mouse was immunized with a partial peptide (IYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSV LLE (SEQ ID NO.: 12)) as an antigen. Spleen cells were removed from the immunized mouse and fused to myeloma cells. The fused cells were screened for cells producing an antibody which binds to the antigen.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
concentrationaaaaaaaaaa
ER stressaaaaaaaaaa
resistanceaaaaaaaaaa
Login to View More

Abstract

The present invention provides a composition for regulating cell proliferation comprising a peptide having a partial amino acid sequence of BBF2H7 or an antibody capable of binding to the peptide. The problem has been solved by preparation of the peptide having a partial amino acid sequence of BBF2H7 which has a cell proliferation activity.

Description

TECHNICAL FIELD[0001]The present application claims priority to Japanese patent application no. 2012-189369 filed on Aug. 30, 2012, the content of which is incorporated herein by reference in its entirety.[0002]The present invention relates to use of a peptide having a partial amino acid sequence of BBF2H7 (BBF2 human homologue on chromosome 7), a nucleic acid molecule encoding the amino acid sequence, or an antibody against the BBF2H7 partial peptide for regulating cell proliferation, i.e. for promoting cell proliferation or suppressing cell proliferation.BACKGROUND ART[0003]Most of proteins are synthesized in the endoplasmic reticulum (ER) in cells and appropriately folded to gain their proper functions. When cells are exposed to an abnormal environment, the function of the ER may be disrupted and a large amount of defective proteins may be produced in the ER. Cells have some proteins which can detect such abnormal situations as above. When the abnormal situation has been detected...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(United States)
IPC IPC(8): C07K16/28A61K38/17G01N33/50C12N15/115
CPCC07K16/28C12N15/115A61K38/177C07K2317/76C12N2310/14C12N2320/30C07K2317/73G01N33/5011A61K31/713A61K38/1709A61P35/00A61P43/00C07K14/4705C07K16/18
InventorIMAIZUMI, KAZUNORISAITO, ATSUSHI
OwnerHIROSHIMA UNIVERSITY