Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

16results about How to "Increase proliferative activity" patented technology

Naphthopyrimidino-fused heteroazasugar derivatives, methods of synthesis and use thereof

This invention provides a naphthopyrimidine-fused-acid sugar derivative, its synthesis method, and its application, belonging to the field of pharmaceutical technology. The naphthopyrimidine-fused-acid sugar derivative has the structures shown in formulas (I) to (IV). These compounds are obtained by one-step cyclization via a condensation reaction with 1,8-diaminonaphthalene in an organic solvent under the catalysis of a trifluoromethanesulfonate catalyst, using a propionyl-protected and p-toluenesulfonated sugar as the starting material. The preparation method is efficient and simple. The compounds of this invention exhibit good anti-proliferative activity against colon cancer tumor cells.
Owner:HEBEI UNIVERSITY

An active peptide, cosmetics containing the active peptide, and their applications

ActiveCN118994318BHas antioxidantHas anti-aging properties
This invention discloses an active peptide, a cosmetic containing the active peptide, and its applications, belonging to the field of cosmetic technology. The amino acid sequence of the active peptide is MQWNCPLGSAVITLHYRGDK. This invention has experimentally demonstrated the use of this active peptide in the preparation of anti-skin aging cosmetics. The polypeptide of this application has antioxidant, cell proliferation enhancement, anti-aging, and skin aging delaying effects, and can be used to develop and prepare anti-skin aging cosmetics.
Owner:YONGCHUANG HENGXIN TECH SERVICE (BEIJING) CO LTD

Epitope peptide of ras g13d mutant and t cell receptor recognizing ras g13d mutant

PendingEP4293043A4Increase proliferative activityIncrease secretion levelPeptide/protein ingredientsHydrolases
The present invention provides an epitope peptide of a RAS G13D mutant, an antigen presenting cell expressing the epitope peptide, a tumor vaccine containing the antigen presenting cell, and a use of the tumor vaccine in the prevention or treatment of a tumor having RAS G13D mutation. The present invention also provides a T cell receptor (TCR) specifically recognizing a RAS G13D mutant, a conjugate and a fusion protein containing the TCR, an immune cell expressing the TCR, a T cell drug containing the immune cell, and a use of the T cell drug in the prevention or treatment of a tumor having RAS G13D mutation.
Owner:SHANGHAI GENBASE BIOTECH CO LTD

A recombinant human-derived k14 keratin and a preparation method and application thereof

ActiveCN121021661BIncrease proliferative activitypromote growth
The application provides a recombinant human K14 keratin and a preparation method and application thereof, and relates to genetic engineering technology. The recombinant human K14 keratin has cell adhesion activity and comprises at least x continuous amino acid residues in SEQ ID NO. 10; wherein, 472 > x > 36. The recombinant human K14 keratin has higher cell proliferation activity and skin repair function, has low production cost, and is suitable for large-scale production.
Owner:ZHUHAI BIRUI MEDICAL TECH CO LTD

A recombinant human collagen xv and preparation method and application thereof

The application relates to the technical field of bioengineering, and particularly discloses a recombinant human collagen XV and a preparation method and application thereof. The amino acid sequence of the recombinant human collagen XV is shown as SEQ ID NO. 1. The recombinant human collagen XV is derived from human collagen, and has no rejection and sensitization risks. Experiments show that the protein has good effects of promoting cell proliferation and promoting cell migration, and has good biocompatibility, and can be applied as a safe and effective biomedical material.
Owner:NORTHWEST UNIV

Pearl powder protein polypeptide CCP sequence and drug application thereof

PendingCN121779524ANo inhibitory activity against proliferationIncrease proliferative activityPeptide/protein ingredientsImmunological disordersPharmacy medicinePharmaceutical drug
The invention discloses a pearl powder protein polypeptide CCP sequence and a medicine application of the pearl powder protein polypeptide CCP sequence. The amino acid sequence of the pearl powder protein polypeptide CCP sequence is CGPCPTVTNAYILDGPYLIGTDREYQCATGYGLVGSAYITCQPDGTWTKPNLQC; the compound has the effects of promoting the proliferation activity of A375 melanoma cells and improving the concentrations of C3 and C4 of the A375 cells, can be used for preparing medicines or foods for regulating complement system activation and enhancing the immunity of a human body, and can also be used for preparing targeted medicines for regulating a complement system.
Owner:SHAOXING UNIVERSITY

Method for promoting proliferation of immature bone marrow-derived macrophages and polarization of immature bone marrow-derived macrophages to M1 through stress application culture and application of method

The invention belongs to the technical field of biological medicines, and particularly relates to a method for promoting proliferation of immature bone marrow-derived macrophages and polarization of the immature bone marrow-derived macrophages to M1 through stress application culture and application of the method. The in-vitro stress application culture method of the macrophages from the immature bone marrow has the characteristics of high stability, high amplification efficiency, polarization controllability, high purity, flexibility in application, low production cost and the like; the problems that a traditional cell factor induction method is low in amplification efficiency, poor in polarization controllability, insufficient in purity and the like are solved, the purity of the obtained M1 type macrophage reaches 90% or above, stability is high, and cost is low. The method can be applied to preparation of macrophage drugs for immunoregulation, anti-fibrosis, metabolism regulation, anti-tumor CAR-M and the like, tissue regeneration biological materials, anti-inflammatory drugs, in-vitro diagnosis products and the like, dosage forms are diversified, and a standardized cell preparation scheme is provided for the related biological medicine field.
Owner:GUANGDONG YIER BIOTECHNOLOGY CO LTD

A bone repair scaffold material, its preparation method and application

This invention discloses a bone repair scaffold material, its preparation method, and its application. The preparation method includes the following steps: preparation of a mineralized collagen core spinning solution; adding mangiferin to a PLGA electrospinning solution and stirring to obtain a shell spinning solution; and using the core spinning solution and the shell spinning solution, obtaining the bone repair scaffold material through coaxial electrospinning. In this invention, PLGA and mangiferin together form the shell of the scaffold structure, and the sustained release of mangiferin provides a guarantee for the anti-inflammatory and angiogenic effects of the scaffold material. Simultaneously, it simulates the fibrous structure of the bone matrix, achieving slow degradation of the core and achieving the goal of long-term promotion of bone repair.
Owner:HOSPITAL OF STOMATOLOGY CHINA MEDICAL UNIV

Spermidine composition for inhibiting aging of hair follicle stem cells and promoting growth period and application

The invention discloses a spermidine composition for inhibiting aging of hair follicle stem cells and promoting growth period entry and application, and relates to the technical field of biological medicine and functional skin care. The invention discloses a spermidine composition for inhibiting aging of hair follicle stem cells and promoting growth period entry. The skin care product is prepared from the following components in parts by mass: 0.5 to 3 parts of spermidine, 0.2 to 2 parts of an autophagy activator, 0.5 to 4 parts of an antioxidant, 0.1 to 2 parts of a mitochondrial function accelerant, 0.2 to 3 parts of a microcirculation accelerant, 1 to 6 parts of a skin penetration accelerant, 0.2 to 1 part of a preservative, 0.05 to 0.4 part of a pH regulator and 60 to 95 parts of a carrier matrix. The composition can effectively reduce the aging rate of hair follicle stem cells and remarkably improve the proliferation activity of the hair follicle stem cells, active oxygen free radicals around the hair follicle stem cells can be effectively removed by adding the antioxidant of a novel structure, damage of external stimulation to hair follicles is reduced, and a systematic cell protection and repair mechanism is formed.
Owner:SHANGHAI ERGOTEIN BIOTECHNOLOGY GRP CO LTD

Recombinant human collagen type i and uses thereof

ActiveCN119775391Beasy to produceWith whiteningCell adhesionEngineering
The present patent application discloses a recombinant human collagen type I and its use. The amino acid sequence of the recombinant human collagen type I is shown in SEQ ID No: 2. The recombinant human collagen type I has good cell proliferation activity, cell migration activity, cell adhesion activity (all better than full-length recombinant human collagen type I or commercially available human collagen), and is easy to produce. The recombinant human collagen type I is expected to have the effects of whitening, moisturizing, soothing and repairing, and can be applied in the fields of cosmetics, external use drugs, skin care products, health care products, tissue engineering materials, medical devices and the like.
Owner:SHAANXI GIANT BIOTECHNOLOGY CO LTD

Use of nras mutations in chronic lymphocytic leukemia

PendingCN122503504AInhibit apoptosisIncrease proliferative activity
This invention belongs to the fields of biomedicine and molecular biology, specifically relating to the application of NRAS mutations in chronic lymphocytic leukemia. Specifically, this invention discloses for the first time the application of NRAS mutations in chronic lymphocytic leukemia. G12D In mutant chronic lymphocytic leukemia (CLL) cells, the transcription factor NFYB is upregulated and directly binds to the CCAAT box of the ARL17B gene promoter, activating ARL17B transcription. High expression of ARL17B significantly promotes CLL cell proliferation, inhibits apoptosis, enhances chemotaxis, and induces resistance to ibrutinib, ederaris, and veneclax, and is closely associated with shortened overall patient survival. This invention not only fills the gap in research on the downstream mechanisms of RAS mutations in CLL, but also provides original experimental evidence for ARL17B as a prognostic biomarker and potential therapeutic target for CLL, possessing significant theoretical value and clinical translational potential.
Owner:SHANDONG PROVINCIAL HOSPITAL AFFILIATED TO SHANDONG FIRST MEDICAL UNIVERSITY (SHANDONG PROVINCIAL HOSPITAL)

PEI-LNPmiR-21 delivery system, preparation method and application thereof, and engineered long-acting stem cell preparation

The invention relates to the technical field of crossing of a stem cell engineering technology, a nano-drug delivery system and a gene therapy technology, in particular to a PEI-LNPmiR-21 delivery system, a preparation method and application thereof and an engineered long-acting stem cell preparation. According to the delivery system, a lipid nanoparticle core is prepared by adopting a microfluidic technology, and low-molecular-weight PEI is covalently grafted on the surface of a lipid layer by utilizing carbodiimide chemistry, so that a nano compound with a core-shell structure is formed. The compound can efficiently deliver miR-21 into stem cells, and by regulating and controlling a PTEN / PI3K / Akt signal channel, the expression of a cell aging marker is remarkably inhibited, the proliferation capacity of the stem cells is enhanced, and the stemness characteristic of the stem cells is maintained.
Owner:SHAANXI ANKEYUAN REGENERATIVE MEDICINE TECHNOLOGY CO LTD

A tumor dual-targeting t cell engager targeting egfr and her2 and uses thereof

The application discloses a tumor double-targeting T cell adapter targeting EGFR and HER2 and an application thereof, and relates to the technical field of biological pharmacy.The TDTCE targeting EGFR and HER2 has good specific T cell activation, proliferation activity and T cell antitumor activity at a cell level, and has good curative effect and safety on solid tumors.Therefore, the tumor double-targeting T cell adapter or a gene coded thereby can be used to prepare an antitumor drug.
Owner:INNOVATION INST FOR ARTIFICIAL INTELLIGENCE IN MEDICINE OF ZHEJIANG UNIV

Use of protein degradation targeting compounds for the preparation of antitumor medicaments

PendingCN122681863Aantiproliferative activityIncrease proliferative activity
The application discloses application of a protein degradation targeting compound to preparation of an antitumor drug. The compound has excellent antitumor cell proliferation activity, and test example data show that multiple compounds have significant concentration-dependent proliferation inhibition effect on colorectal cancer cells. Moreover, the compound has the potential to achieve sustained drug efficacy at a low dose. The compound has good antiproliferation activity on colorectal cancer cells, and therefore has definite potential for preparation of an anticancer drug.
Owner:YANTAI UNIV

Polypeptide, recombinant X-type humanized collagen composed of polypeptide and application of recombinant X-type humanized collagen

PendingCN121949509AIncrease productionSuitable for industrial preparationFermentationAnimals/human peptidesHuman bodyCell adhesion
The invention relates to the technical field of biology, and particularly discloses a polypeptide, a recombinant X-type humanized collagen composed of the polypeptide and application of the recombinant X-type humanized collagen. A functional unit polypeptide of the present invention comprises a humanized alpha I chain protein or a variant thereof; wherein the sequence of the humanized alpha I chain protein is SEQ ID NO: 22, and the variant comprises one or more of the following mutations relative to the humanized alpha I chain protein: sequence truncation, site mutation / substitution and sequence addition. The recombinant polypeptide taking the functional unit polypeptide as a repetitive unit can promote cell proliferation activity and cell adhesion activity, and can be used for medical or non-medical application and filling, capacity increasing or repairing scenes of a plurality of tissues and organs of a human body.
Owner:SHANXI JINBO BIO PHARMACEUTICAL CO LTD

Multi-target, multi-functional anti-hair loss polypeptide, application and preparation method thereof

ActiveCN121319113BIncrease proliferative activityAvoid activity decayCosmetic preparationsHair cosmeticsCyclic peptideDisulfide bonding
The application belongs to the technical field of medicine and cosmetics, and specifically discloses a multi-target and multi-functional anti-hair loss and hair growth polypeptide, application and preparation method thereof. The polypeptide is a cyclic peptide, and the amino acid sequence is shown as SEQ ID No. 1. The N terminal of the cyclic peptide is modified by acetylation, the C terminal is modified by amidation, the third cysteine and the sixth cysteine in the sequence form an intramolecular disulfide bond. The polypeptide is prepared by using a solid-phase synthesis method, and high-purity target polypeptide is obtained after cutting and purification. According to the specified test report, the polypeptide has a clear proliferation promoting effect on human hair papilla cells, the test process conforms to the standard operating instruction, and the detection result has scientificity, impartiality and accuracy. The polypeptide can be used for preparing anti-hair loss and hair growth related products, can provide efficient and stable biological active material for anti-hair loss and hair growth, and meets the demand of the anti-hair loss and hair growth field for high-quality active ingredients.
Owner:DO YOU KNOW MEILI BIOTECHNOLOGY (SICHUAN) CO LTD