25results about How to "Increase proliferative activity" patented technology

The invention provides an enzymolysis method of oat milk for promoting proliferation of lactobacillus plantarum and bifidobacterium. According to the invention, through the synergistic effect of in-situ enzymolysis of oat endogenous protease and glucanase and enzymolysis of free enzyme, on the basis, through enzymolysis of proper protease, the obtained oat milk contains oat polypeptide and oat beta-glucan with proper molecular weights, and has remarkable activity of promoting proliferation of lactobacillus plantarum and bifidobacterium.

The invention discloses dipeptide hydrogel and application thereof as a cell culture medium, and belongs to the field of material science. According to the invention, the dipeptide hydrogel is designed and assembled, and the dipeptide hydrogel is prepared by the following steps: carrying out self-assembly on phenylalanine dipeptide modified by 9-fluorenyl methoxy carbonyl protecting group (Fmoc), and then adding tetracarboxyl phenyl porphyrin (TCPP) and distearoyl phosphatidyl ethanolamine (DSPE) for co-assembly. When the dipeptide hydrogel prepared by the invention is applied as a cell culture medium, the proliferation activity of cultured cells can be improved, so that the growth speed and density of the cells are improved, and the dipeptide hydrogel has good biological safety. The possibility is provided for promoting the high-level development of the cell culture field.

This invention provides a naphthopyrimidine-fused-acid sugar derivative, its synthesis method, and its application, belonging to the field of pharmaceutical technology. The naphthopyrimidine-fused-acid sugar derivative has the structures shown in formulas (I) to (IV). These compounds are obtained by one-step cyclization via a condensation reaction with 1,8-diaminonaphthalene in an organic solvent under the catalysis of a trifluoromethanesulfonate catalyst, using a propionyl-protected and p-toluenesulfonated sugar as the starting material. The preparation method is efficient and simple. The compounds of this invention exhibit good anti-proliferative activity against colon cancer tumor cells.

This invention discloses an active peptide, a cosmetic containing the active peptide, and its applications, belonging to the field of cosmetic technology. The amino acid sequence of the active peptide is MQWNCPLGSAVITLHYRGDK. This invention has experimentally demonstrated the use of this active peptide in the preparation of anti-skin aging cosmetics. The polypeptide of this application has antioxidant, cell proliferation enhancement, anti-aging, and skin aging delaying effects, and can be used to develop and prepare anti-skin aging cosmetics.

The present invention provides an epitope peptide of a RAS G13D mutant, an antigen presenting cell expressing the epitope peptide, a tumor vaccine containing the antigen presenting cell, and a use of the tumor vaccine in the prevention or treatment of a tumor having RAS G13D mutation. The present invention also provides a T cell receptor (TCR) specifically recognizing a RAS G13D mutant, a conjugate and a fusion protein containing the TCR, an immune cell expressing the TCR, a T cell drug containing the immune cell, and a use of the T cell drug in the prevention or treatment of a tumor having RAS G13D mutation.

The present invention discloses a recombinant fibronectin fusion protein and its application. The recombinant fibronectin fusion protein includes a recombinant fibronectin mutant (FN1) and platelet factor 4 (PF4); the amino acid sequence of the recombinant fibronectin fusion protein is shown in SEQ ID NO.3 or SEQ ID NO.4. The recombinant fibronectin fusion protein of the present invention has a molecular weight of less than 90KDa, good solubility, a simple preparation process, and convenient purification; the recombinant fibronectin fusion protein provided by the present invention has a novel recombinant fibronectin, which can inhibit inflammation during wound healing, thereby efficiently promoting the healing of mouse skin injuries, and can provide new ideas for the development of wound healing drugs. Moreover, when the present invention creatively fuses platelet factor 4 to the N-terminus of the fibronectin mutant, it can significantly and effectively promote cell proliferation activity.

The application provides a recombinant human K14 keratin and a preparation method and application thereof, and relates to genetic engineering technology. The recombinant human K14 keratin has cell adhesion activity and comprises at least x continuous amino acid residues in SEQ ID NO. 10; wherein, 472 > x > 36. The recombinant human K14 keratin has higher cell proliferation activity and skin repair function, has low production cost, and is suitable for large-scale production.

The application relates to the technical field of bioengineering, and particularly discloses a recombinant human collagen XV and a preparation method and application thereof. The amino acid sequence of the recombinant human collagen XV is shown as SEQ ID NO. 1. The recombinant human collagen XV is derived from human collagen, and has no rejection and sensitization risks. Experiments show that the protein has good effects of promoting cell proliferation and promoting cell migration, and has good biocompatibility, and can be applied as a safe and effective biomedical material.

The invention relates to a bone mechanics matching shell-imitating structure bioactive ceramic-based composite material as well as a preparation method and application thereof. The osteomechanics matching shell-imitating structure bioactive ceramic-based composite material comprises an ordered layered porous structure biological ceramic matrix and biocompatible high polymer materials which are uniformly distributed on the surface and inside the ordered layered porous structure biological ceramic matrix, a biological ceramic element of the ordered layered porous structure biological ceramic matrix comprises brushite powder, an aluminum oxide nanosheet, a hydroxyapatite microrod, a calcium silicate nanowire or a graphene oxide nanosheet, and preferably the brushite powder; the biocompatible high polymer material comprises at least one of polymethyl methacrylate, polyvinyl alcohol, sodium polyacrylate, polyacrylamide and sodium alginate.

The present invention relates to the field of biomedicine technology, and in particular, to an application of mesenchymal stem cells in the treatment of idiopathic pulmonary fibrosis. The present invention improves the separation and preparation method of adipose-derived mesenchymal stem cells, and the adipose-derived mesenchymal stem cells prepared using a new culture medium have higher proliferation activity. TGF-β induction leads to increased expression of SP-C and α-SMA proteins and decreased expression of E-Cadherin, while the addition of a combination of mesenchymal stem cells derived from human adipose tissue and dextromethorphan alleviates this phenomenon, thereby achieving the treatment of idiopathic pulmonary fibrosis, providing a new direction for the treatment of idiopathic pulmonary fibrosis, and having great application value.

The invention discloses a pearl powder protein polypeptide CCP sequence and a medicine application of the pearl powder protein polypeptide CCP sequence. The amino acid sequence of the pearl powder protein polypeptide CCP sequence is CGPCPTVTNAYILDGPYLIGTDREYQCATGYGLVGSAYITCQPDGTWTKPNLQC; the compound has the effects of promoting the proliferation activity of A375 melanoma cells and improving the concentrations of C3 and C4 of the A375 cells, can be used for preparing medicines or foods for regulating complement system activation and enhancing the immunity of a human body, and can also be used for preparing targeted medicines for regulating a complement system.

The invention belongs to the technical field of biological medicines, and particularly relates to a method for promoting proliferation of immature bone marrow-derived macrophages and polarization of the immature bone marrow-derived macrophages to M1 through stress application culture and application of the method. The in-vitro stress application culture method of the macrophages from the immature bone marrow has the characteristics of high stability, high amplification efficiency, polarization controllability, high purity, flexibility in application, low production cost and the like; the problems that a traditional cell factor induction method is low in amplification efficiency, poor in polarization controllability, insufficient in purity and the like are solved, the purity of the obtained M1 type macrophage reaches 90% or above, stability is high, and cost is low. The method can be applied to preparation of macrophage drugs for immunoregulation, anti-fibrosis, metabolism regulation, anti-tumor CAR-M and the like, tissue regeneration biological materials, anti-inflammatory drugs, in-vitro diagnosis products and the like, dosage forms are diversified, and a standardized cell preparation scheme is provided for the related biological medicine field.

This invention discloses a bone repair scaffold material, its preparation method, and its application. The preparation method includes the following steps: preparation of a mineralized collagen core spinning solution; adding mangiferin to a PLGA electrospinning solution and stirring to obtain a shell spinning solution; and using the core spinning solution and the shell spinning solution, obtaining the bone repair scaffold material through coaxial electrospinning. In this invention, PLGA and mangiferin together form the shell of the scaffold structure, and the sustained release of mangiferin provides a guarantee for the anti-inflammatory and angiogenic effects of the scaffold material. Simultaneously, it simulates the fibrous structure of the bone matrix, achieving slow degradation of the core and achieving the goal of long-term promotion of bone repair.

The invention discloses a spermidine composition for inhibiting aging of hair follicle stem cells and promoting growth period entry and application, and relates to the technical field of biological medicine and functional skin care. The invention discloses a spermidine composition for inhibiting aging of hair follicle stem cells and promoting growth period entry. The skin care product is prepared from the following components in parts by mass: 0.5 to 3 parts of spermidine, 0.2 to 2 parts of an autophagy activator, 0.5 to 4 parts of an antioxidant, 0.1 to 2 parts of a mitochondrial function accelerant, 0.2 to 3 parts of a microcirculation accelerant, 1 to 6 parts of a skin penetration accelerant, 0.2 to 1 part of a preservative, 0.05 to 0.4 part of a pH regulator and 60 to 95 parts of a carrier matrix. The composition can effectively reduce the aging rate of hair follicle stem cells and remarkably improve the proliferation activity of the hair follicle stem cells, active oxygen free radicals around the hair follicle stem cells can be effectively removed by adding the antioxidant of a novel structure, damage of external stimulation to hair follicles is reduced, and a systematic cell protection and repair mechanism is formed.

The present patent application discloses a recombinant human collagen type I and its use. The amino acid sequence of the recombinant human collagen type I is shown in SEQ ID No: 2. The recombinant human collagen type I has good cell proliferation activity, cell migration activity, cell adhesion activity (all better than full-length recombinant human collagen type I or commercially available human collagen), and is easy to produce. The recombinant human collagen type I is expected to have the effects of whitening, moisturizing, soothing and repairing, and can be applied in the fields of cosmetics, external use drugs, skin care products, health care products, tissue engineering materials, medical devices and the like.

This invention belongs to the fields of biomedicine and molecular biology, specifically relating to the application of NRAS mutations in chronic lymphocytic leukemia. Specifically, this invention discloses for the first time the application of NRAS mutations in chronic lymphocytic leukemia. G12D In mutant chronic lymphocytic leukemia (CLL) cells, the transcription factor NFYB is upregulated and directly binds to the CCAAT box of the ARL17B gene promoter, activating ARL17B transcription. High expression of ARL17B significantly promotes CLL cell proliferation, inhibits apoptosis, enhances chemotaxis, and induces resistance to ibrutinib, ederaris, and veneclax, and is closely associated with shortened overall patient survival. This invention not only fills the gap in research on the downstream mechanisms of RAS mutations in CLL, but also provides original experimental evidence for ARL17B as a prognostic biomarker and potential therapeutic target for CLL, possessing significant theoretical value and clinical translational potential.

The invention relates to the technical field of crossing of a stem cell engineering technology, a nano-drug delivery system and a gene therapy technology, in particular to a PEI-LNPmiR-21 delivery system, a preparation method and application thereof and an engineered long-acting stem cell preparation. According to the delivery system, a lipid nanoparticle core is prepared by adopting a microfluidic technology, and low-molecular-weight PEI is covalently grafted on the surface of a lipid layer by utilizing carbodiimide chemistry, so that a nano compound with a core-shell structure is formed. The compound can efficiently deliver miR-21 into stem cells, and by regulating and controlling a PTEN / PI3K / Akt signal channel, the expression of a cell aging marker is remarkably inhibited, the proliferation capacity of the stem cells is enhanced, and the stemness characteristic of the stem cells is maintained.

The invention discloses a hydroximic acid compound with a structure as shown in a formula (I) or a pharmaceutically acceptable salt or a stereoisomer of the hydroximic acid compound, and application of the hydroximic acid compound or the pharmaceutically acceptable salt or the stereoisomer. The invention provides a hydroximic acid compound, and discovers that a hydroximic acid group can be covalently bound with a lysine residue of a target protein after being oxidized through a novel efficient oxidation induction strategy, the lysine residue in the protein or polypeptide can be selectively and covalently modified, and the modification of the lysine residue has high selectivity and high efficiency; the method can be used for protein activity research, and has important significance on chemical proteomics application. # imgabs0 #

The present invention relates to the field of cell culture technology, and in particular to a CIK cell culture method and application thereof. The culture method comprises the following steps: (1) isolating peripheral blood mononuclear cells (PBMC); (2) preparing culture medium A; (3) preparing culture medium B; (4) resuspending and inoculating peripheral blood mononuclear cells; and (5) collecting cell culture. The culture method of the present invention can improve the yield of CIK cells, and wherein CD3 + CD56 + The proportion of double-positive cells is high, which increases cell proliferation activity and promotes the increase of CIK cell proliferation and killing activity.

The invention provides a protein-like modified edible peptide with an osteogenesis promoting effect and a preparation method thereof. The preparation method comprises the following steps: (1) preparing a salmon skin gelatin solution; (2) preparing salmon skin gelatin hydrolysate by using papain; (3) introducing glycine into the hydrolysate under the catalysis of papain; and (4) carrying out proteoid reaction on the salmon skin gelatin hydrolysate to prepare the proteoid modified peptide. According to the novel protein-like modified edible peptide with the osteogenesis promoting effect and the preparation method of the novel protein-like modified edible peptide, the osteogenesis promoting functional characteristics of salmon skin gelatin hydrolysate are improved, and the salmon skin gelatin protein-like modified peptide provides nutritional and health-care effects for promoting bone growth, bone regeneration, bone health care and osteoporosis prevention; the composition can be used as a potential oral supplement for bone joint tissue recovery. The invention belongs to the technical field of health food processing, and the edible peptide has the advantages of edibility, compatibility and safety, can be easily and fully absorbed by human bodies, and has the advantages of strengthening bodies of specific osteoporosis people and the like.

The application discloses a tumor double-targeting T cell adapter targeting EGFR and HER2 and an application thereof, and relates to the technical field of biological pharmacy.The TDTCE targeting EGFR and HER2 has good specific T cell activation, proliferation activity and T cell antitumor activity at a cell level, and has good curative effect and safety on solid tumors.Therefore, the tumor double-targeting T cell adapter or a gene coded thereby can be used to prepare an antitumor drug.

The application discloses application of a protein degradation targeting compound to preparation of an antitumor drug. The compound has excellent antitumor cell proliferation activity, and test example data show that multiple compounds have significant concentration-dependent proliferation inhibition effect on colorectal cancer cells. Moreover, the compound has the potential to achieve sustained drug efficacy at a low dose. The compound has good antiproliferation activity on colorectal cancer cells, and therefore has definite potential for preparation of an anticancer drug.

The invention relates to a preparation method of a muscle cell exosome for microRNA loading. The preparation method specifically comprises the following steps: step 1, culturing C2C12 cells in a C2C12 cell culture medium prepared from fetal calf serum, DMEM (dulbecco's modified eagle medium), double antibodies, glutathione and arginine; step 2, carrying out exosome extraction on the C2C12 cells, carrying out multiple times of differential centrifugation, and sequentially carrying out exosome washing and exosome purification; and step 3, carrying out microRNA (Ribonucleic Acid) loading on the obtained C2C12 cell exosome in a sterile state. Meanwhile, the invention also provides application of the exosome prepared by the preparation method in promoting proliferation and activity of muscle cells. According to the method, the secretion capacity of the exosome is improved by adopting the improved culture medium, and the loading efficiency and the stability of the microRNA are remarkably improved by combining an exosome transfer technology.

The invention relates to the technical field of biology, and particularly discloses a polypeptide, a recombinant X-type humanized collagen composed of the polypeptide and application of the recombinant X-type humanized collagen. A functional unit polypeptide of the present invention comprises a humanized alpha I chain protein or a variant thereof; wherein the sequence of the humanized alpha I chain protein is SEQ ID NO: 22, and the variant comprises one or more of the following mutations relative to the humanized alpha I chain protein: sequence truncation, site mutation / substitution and sequence addition. The recombinant polypeptide taking the functional unit polypeptide as a repetitive unit can promote cell proliferation activity and cell adhesion activity, and can be used for medical or non-medical application and filling, capacity increasing or repairing scenes of a plurality of tissues and organs of a human body.

The application belongs to the technical field of medicine and cosmetics, and specifically discloses a multi-target and multi-functional anti-hair loss and hair growth polypeptide, application and preparation method thereof. The polypeptide is a cyclic peptide, and the amino acid sequence is shown as SEQ ID No. 1. The N terminal of the cyclic peptide is modified by acetylation, the C terminal is modified by amidation, the third cysteine and the sixth cysteine in the sequence form an intramolecular disulfide bond. The polypeptide is prepared by using a solid-phase synthesis method, and high-purity target polypeptide is obtained after cutting and purification. According to the specified test report, the polypeptide has a clear proliferation promoting effect on human hair papilla cells, the test process conforms to the standard operating instruction, and the detection result has scientificity, impartiality and accuracy. The polypeptide can be used for preparing anti-hair loss and hair growth related products, can provide efficient and stable biological active material for anti-hair loss and hair growth, and meets the demand of the anti-hair loss and hair growth field for high-quality active ingredients.