371 results about "Tissue engineering" patented technology

The invention relates to the technical field of biology, and particularly discloses a recombinant collagen III and application thereof in preparation of gel. The recombinant collagen III is designed by optimizing functional area sequences of human I-type and III-type collagen, the amino acid sequence is shown as SEQ ID No.2, and the recombinant collagen III has the characteristics of high stability, good hydrophilicity and low immunogenicity. The preparation method comprises the steps of expression vector construction, escherichia coli induced expression, affinity chromatography purification and renaturation. The recombinant collagen III can be prepared into a gel dressing and comprises sodium alginate, methylparaben and other components. Experiments show that the gel can effectively promote cell proliferation and has no cytotoxicity; in a mouse skin injury model, the collagen can relieve inflammation, accelerate wound healing and inhibit scar formation, and the effect of the collagen is superior to that of natural human III-type collagen. The invention provides a safe and efficient novel material for wound repair, and is suitable for medical dressings and tissue engineering.

The invention relates to the technical field of synthetic biology, in particular to recombinant XVII type collagen as well as a preparation method and application thereof.The amino acid sequence of the recombinant XVII type collagen comprises a sequence shown in any one of SEQ ID NO.1-SEQ ID NO.3. The recombinant XVII type collagen can be highly expressed in an escherichia coli and pichia pastoris system, the expression system is simple, the cost is low, and the recombinant XVII type collagen is suitable for industrial production. The yield is high; the biological activity is good. The protein can be compounded with other proteins to form raw materials of tissue engineering products, cosmetics, health care products or medicines, so that the protein can be widely applied to the fields of medicines, medical instruments, biological materials, tissue engineering, cosmetics and the like.

The invention belongs to the technical field of biomedical tissue engineering materials, and particularly relates to injectable composite plastic gel and a preparation method thereof. The injectable plastic gel provided by the invention is formed by suspending and compounding the cross-linked sodium hyaluronate gel particles and the biological tissue extracellular matrix particles, the two material particles in the injectable composite plastic gel are uniform in size and controllable in size, other toxic catalysts do not need to be added in the preparation process, and the injectable plastic gel is easy to prepare. The collagen / elastin composite material is rich in collagen and elastin, and shows good biomechanical properties. Meanwhile, the composite plastic gel contains a plurality of bioactive factors, and after the composite plastic gel is injected and filled into a body, the composite plastic gel is slowly degraded and can promote the generation and ingrowth of autologous fat cells and microvessels, so that the balance of degradation and remodeling is achieved. The preparation method of the injectable plastic gel provided by the invention can be widely applied to the fields of plastic surgery, medical beauty and the like.

The utility model relates to the technical field of biological tissue engineering, in particular to an organ chip platform integrated with optical tweezers, which is used for assembling and culturing three-dimensional cell tissues and comprises an organ chip with optical transparency and holographic optical tweezers integrated with the organ chip. The organ chip is horizontally arranged and comprises an upper-layer plate, a middle-layer plate and a lower-layer plate which are sequentially stacked, the middle-layer plate is provided with at least two first culture pools used for inducing and differentiating stem cells into different types of cells and at least one second culture pool used for assembling and culturing the different types of cells, and the lower-layer plate is provided with at least two second culture pools used for assembling and culturing the different types of cells. The channel is connected with the first culture pond and the second culture pond; and an objective lens of the holographic optical tweezers faces the top surface or the bottom surface of the organ chip and is used for capturing, moving and assembling cells in the first culture pool or the second culture pool. According to the utility model, the dependence on a micro-pattern processing technology can be reduced, the cost is reduced, and the regulation and control capability on an organoid tissue structure is improved.

The invention discloses starch-collagen composite hydrogel as well as a preparation method and application thereof. Collagen is catalyzed by microbial transglutaminase to form a covalent cross-linked network, and meanwhile, hydroxypropyl starch is introduced to construct a physical interpenetrating network through molecular chain penetration and hydrogen-bond interaction; and chondroitin sulfate is further integrated to strengthen the network structure and biological activity through electrostatic interaction. The method is mild in condition and does not need a toxic chemical cross-linking agent, the obtained composite hydrogel has an interpenetrating double-network structure and has excellent mechanical properties, enzymatic degradation resistance and cell affinity, the compression modulus of the composite hydrogel is remarkably improved, the composite hydrogel can keep structural stability for a long time in a collagenase environment, cell adhesion and proliferation can be effectively promoted, and the composite hydrogel has a good application prospect. The hydrogel can be widely applied to tissue engineering scaffolds, wound dressings, drug sustained-release carriers and cartilage repair materials.

Provided herein are devices and methods that represent a dual function approach to tissue engineering and regenerative medicine, particularly for bone fracture or segmental defect healing. The devices include an implantable substrate; a first active composition, and a second active composition that comprises one or more oxygen-modulating compositions. The incorporation of dual bioactive compositions on the substrate offers a versatile platform for manipulating cells and modulating the local tissue oxygen environment at the site of implantation.

The invention discloses composite hydrogel bio-ink with a function of space-time delivery of double growth factors as well as a preparation method and application of the composite hydrogel bio-ink, and belongs to the technical field of biomedical materials and tissue engineering. According to the preparation method, imidazolyl-modified methacrylated gelatin and double-bonded PF127 are compounded, and meanwhile, free vascular endothelial growth factors and connective tissue growth factor-loaded PLGA microspheres are entrapped in a system, so that the bio-ink with excellent printability, high adhesion, swelling resistance and space-time delivery function is formed; the bio-ink physically has the advantages of high printing fidelity, low swelling property, high mechanical strength and strong tissue adhesion of a synthetic material; in biology, the system can be used as an intelligent carrier to realize programmed space-time delivery of various growth factors, so that complex cell biological behaviors are accurately arranged, and real regeneration of functional tissues is guided.

The present disclosure relates to a protein-based article comprising a film having a thickness of about 0.1 μm to about 10 mm and comprising a crosslinked network of partially ordered polypeptides, wherein each partially ordered polypeptide independently comprises a plurality of disordered domains and a plurality of ordered domains, wherein each disordered domain independently comprises a PG or GP motif and each ordered domain independently comprises a polyalanine motif or a polyproline motif.

The invention relates to composite hydrogel for tissue repair as well as a preparation method and application of the composite hydrogel. The composite hydrogel is prepared from a methacrylated acellular matrix, nano clay (LAP), a photoinitiator, carboxymethyl chitosan (CMCS) and water. The acellular matrix is modified through methylacryloylation, and a polymer network is reinforced by combining nano-clay, so that the mechanical strength is improved; and carboxymethyl chitosan adjusts the degradation rate, constructs a pore structure and endows antibacterial and anti-inflammatory functions. The preparation method comprises the following steps: dissolving the methacrylated acellular matrix in the PBS containing the photoinitiator, dissolving the carboxymethyl chitosan in ultrapure water, mixing, and carrying out illumination cross-linking curing. When the composite hydrogel is applied to small intestine tissue engineering, a small intestine defect part can be filled with the composite hydrogel, photo-crosslinking curing is performed to form a stent, the degradation period is matched with the small intestine regeneration period, and the antibacterial rate is gt; the cell toxicity is 0 level, a good microenvironment can be provided for cells, tissue repair can be promoted, and the compound can also be used for preparing pharmaceutical compositions for treating small intestine related diseases.

The invention belongs to the technical field of hydrogel preparation, and discloses a biocompatible self-healing photocuring hydrogel and a preparation method and a use method thereof.The biocompatible self-healing photocuring hydrogel is prepared by adding an ultraviolet light initiator and sodium chloride into a polyvinyl alcohol aqueous solution, evenly mixing, then adding acryloyl glycinamide powder to enable the acryloyl glycinamide powder to be dissolved, then adding a crosslinking agent, and evenly mixing to obtain the biocompatible self-healing photocuring hydrogel. Adding water into the mixed solution, then removing bubbles, then adding methacrylated gelatin and dissolving, and then removing bubbles to obtain a biocompatible self-healing photocuring hydrogel mixed solution; adding a borax solution prepared from sodium tetraborate and deionized water into the obtained biocompatible self-healing light-cured hydrogel mixed solution, and after the biocompatible self-healing light-cured hydrogel mixed solution and the borax solution are subjected to cross-linking reaction, removing bubbles to obtain the biocompatible self-healing light-cured hydrogel. The biocompatible self-healing photocuring hydrogel has excellent mechanical properties and self-healing ability, and is suitable for application scenes such as biosensing, wound repair and tissue engineering.

The invention discloses a culture method of high-activity human urine-derived stem cells, which relates to the technical field of biological medicine, and is technically characterized by comprising the following steps: collecting urine samples of pregnant and lying-in women, coating a culture plate with gelatin, inducing adherence, performing passage amplification, performing immunofluorescence identification, performing function detection and other optimized conditions, and separating and culturing the stem cells. Compared with urine-derived stem cells of normal adults, the stem cells derived from pregnant women have stronger activity, higher dryness and faster multiplication capacity. The invention provides a novel and superior cell source for tissue engineering and regenerative medicine.

The invention relates to the technical field of biomedical materials, and discloses an antioxidant nano double-response drug delivery system and a preparation method and application thereof.The preparation method comprises the steps that mesoporous bioactive glass nano-particles with the particle size being 100-400 nm, the aperture being 2-10 nm and the specific surface area being 200-800 m < 2 > / g are adopted, amino functionalization is conducted on the surfaces, and the mesoporous bioactive glass nano-particles are prepared; the preparation method comprises the following steps: adsorbing a micromolecular antioxidant drug to mesoporous channels and surfaces of nanoparticles by using a rotary evaporation method, and finally grafting a pH-sensitive and ROS-responsive gated polymer by adopting an amide reaction to construct a nano drug delivery system capable of releasing the antioxidant drug in a pH-ROS dual-response manner, and the nano drug delivery system has good biocompatibility, and can be used for preparing a drug delivery system for the antioxidant drug in a pH-ROS dual-response manner. Antioxidant drugs can be released by intelligently responding to low pH and high ROS; by releasing small-molecule antioxidant drugs, free radicals are eliminated, oxidative stress is relieved, inflammatory response is inhibited, and the hydrogel has good application prospects in the fields of diabetes mellitus chronic wound healing, tissue engineering drug release, cancer treatment, tumor resistance and the like.

The invention belongs to the technical direction of protein engineering in the technical field of biology, and particularly relates to a triple-helix folding and stabilizing method for recombinant collagen, which is a technology for efficiently assisting correct folding of human recombinant collagen expressed by escherichia coli and forming a stable triple-helix structure. The technology mainly solves the common key technical problems of low folding efficiency, unstable triple helix structure and the like of the recombinant collagen in an escherichia coli expression system, and obviously improves the yield of the functional recombinant collagen. The method has important application value in the fields of biomedical materials, tissue engineering, beauty and skin care and the like, and an efficient and economical technical path is provided for industrial production of recombinant collagen.

The invention relates to the technical field of biological materials, in particular to composite hydrogel as well as a preparation method and application thereof. In particular to an ion response type ELPs-SA composite hydrogel constructed based on elastin-like polypeptides (ELPs) and sodium alginate (SA) as well as a preparation method and application of the ion response type ELPs-SA composite hydrogel. According to the hydrogel, elastic-like polypeptides ELP-Vs (such as adhesion promotion, angiogenesis, antibiosis and the like) with biological functions are introduced and react with SA, CaCO3 and gluconolactone (GDL) together, and the non-covalent cross-linked three-dimensional network hydrogel is formed under mild conditions. The obtained hydrogel has excellent mechanical strength (the energy storage modulus is 450-1773 Pa), a proper microporous structure (the pore diameter is 50-100 microns) and good biocompatibility, and can support three-dimensional culture of cells and promote angiogenesis and immunoregulation. The material has a wide application prospect in the biomedical fields of tissue engineering, wound repair, organoid construction and the like.

The invention provides a culture medium composition and a method for preparing mesenchymal stem cells. The culture medium combination comprises a culture medium A, a culture medium B and a differential culture medium, the culture medium A comprises a basic culture medium and a first small molecule compound combination, the culture medium B comprises a basic culture medium and a second small molecule compound combination, and the differential culture medium comprises a basic culture medium and a third small molecule compound combination. According to the culture medium and the method, the MSC can be prepared through ES or iPSC, and the culture medium and the method can be widely applied to the fields of regenerative medicine, tissue engineering, immunotherapy and the like.

The invention relates to the technical field of hydrogel, in particular to a preparation process of antibacterial hydrophilic hydrogel and application of the antibacterial hydrophilic hydrogel in organoid tissue engineering. The preparation process comprises the following steps: S1, preparing a base material; the base material is prepared from the following raw materials in parts by weight: 300 to 400 parts of deionized water, 60 to 80 parts of acryloyloxyethyl trimethyl ammonium chloride, 40 to 60 parts of polyoxyethylene, 20 to 30 parts of antibacterial agent, 6 to 10 parts of methyl methacrylate and 1 to 3 parts of photoinitiator 1173. According to the preparation method, the contact area between the silver nanoparticles and bacteria is increased, cell membranes are damaged, silver ions are released, chitosan and beta-sodium glycerophosphate form a temperature-sensitive gel precursor after being dissolved, and due to the fact that chitosan carries positive charges, the bacteria can be adsorbed and cell walls can be damaged through the electrostatic interaction; the chitosan and the silver nanoparticles form a slow-release carrier, so that the release time of silver ions is prolonged, and the antibacterial property of the antibacterial hydrophilic hydrogel is further improved.

The application discloses a kind of biological tissue section rigidity measurement methods based on photonic crystal colorimetric sensor, the method is according to the set step pitch vertically to photonic crystal colorimetric sensor and is pressed down to tissue section, photonic crystal colorimetric sensor is formed by the elastomer of better biocompatibility and is covered photonic crystal, its Young's modulus can be adjusted according to the rigidity range of tissue section, in the process of pressing down, the different deformation of elastomer due to the rigidity of different regions of tissue, the wavelength of internal photonic crystal reflection changes, that is, the color difference of sensor surface is generated, then the rigidity information of tissue section is obtained according to the color difference analysis.The method realizes the rigidity of biological tissue section fast, simple, high-precision detection, and can be applied to the fields such as tissue engineering, organ chip, clinical examination and the like.

The invention relates to a recombinant vector for expressing a natural long-sequence recombinant III-type collagen as well as a preparation method and application of the recombinant vector, and relates to the field of proteins. The nucleotide sequence for optionally coding the recombinant III type collagen has at least one section of nucleotide sequence for coding the amino acid sequence as shown in SEQ ID NO: 1 (optionally has at least one section of nucleotide sequence as shown in any one of SEQ ID NO: 2 to SEQ ID NO: 4). The engineering bacterium for efficiently expressing the III type collagen natural long sequence is constructed through a genetic engineering technology, large-scale production of the engineering bacterium is achieved, and the engineering bacterium can be widely applied to the fields of medicine, clinical skin repair, tissue engineering, beauty and the like.

The invention belongs to the technical field of optimized coding genes, and discloses a recombinant human V-type collagen as well as a preparation method and application thereof, the amino acid sequence of the recombinant human V-type collagen comprises a basic repetitive unit, and the basic repetitive unit is VQGPPGPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHR. The collagen provided by the invention has no cytotoxicity, has good effects of promoting cell proliferation and cell migration, is high in safety, and has the potential of being applied to the fields of medicines, medical instruments, biological materials and tissue engineering.

The present invention relates to a protein-ribonucleic acid complex comprising (I) at least one multi-functional protein or a set of at least two proteins and (II) a nucleic acid editor complex, a polynucleotide encoding the multi-functional protein (I) and its uses in the delivery of nucleic acids and gene editing tools. The present invention also relates to a nucleic acid delivery system, a plurality of polynucleotides, pharmaceutical compositions, a cell or a cell line, and kits. The present invention further relates to medical uses of the nucleic acid delivery system or the cell or cell line. Also provided are uses of a cell or a cell line in therapeutic and diagnostic applications, as well as in tissue engineering. Finally, the present invention further relates to an in vitro or in vivo method of editing a nucleic acid molecule in a target cell, and a method for nucleic acid delivery.

The application discloses a preparation method of a full-biological-base polysaccharide nanofiber-silk fibroin composite water-absorbing hydrogel. The preparation method comprises the following steps: S1, uniformly mixing polysaccharide nanofiber dispersion liquid and silk fibroin solution to obtain a mixed solution, incubating the mixed solution under the condition of 40-80 DEG C for 6-48 h to obtain a composite gel precursor with a three-dimensional string-bead water-collecting structure; S2, solidifying the composite gel precursor by steam bath induction to form a structure-stable composite gel; and S3, drying the composite gel to obtain the full-biological-base polysaccharide nanofiber-silk fibroin composite water-absorbing hydrogel. The preparation method is simple, green and environmentally-friendly, reaction conditions are mild, and no chemical cross-linking agent or toxic reagent needs to be added, thus having important guiding significance for industrialized preparation of the biological-base water-absorbing hydrogel; the full-biological-base polysaccharide nanofiber-silk fibroin composite water-absorbing hydrogel has excellent mechanical properties and water-absorbing properties, and is expected to be applied in the fields of biology, medicine, slow release, tissue engineering, wound healing, optics, electricity, environmental protection, adsorption, daily-use products or composite materials and the like.

The invention discloses a water-soluble silk fibroin with a random crimp / Silk I structure as a main structure as well as a preparation method and application of the water-soluble silk fibroin. The silk fibroin product is characterized in that in a protein secondary structure, the total content of random curls and Silk I structures exceeds 85%, and the proportion of Silk I in the whole crystal structure is not lower than 75%; the product can be directly dissolved in water at room temperature to form a stable clarified solution with the concentration not lower than 5%, and is not gelatinized after being stored at 4 DEG C for 90 days. The preparation method comprises the following steps: degumming and cleaning the mulberry silk raw material; the method comprises the following steps: carrying out short-time (less than or equal to 20 minutes) high-temperature dissolution by adopting a multi-element solution dissolution system with a specific ratio, and then carrying out dialysis purification at a low temperature by taking the conductivity (lt, 10 [mu] S / cm) of a dialysis external liquid and the concentration (lt, 50 ppm) of calcium ions as double end-point standards. The directional regulation and control of the silk fibroin structure are realized through the accurate control of the whole process, and the obtained product has excellent water solubility, storage stability and biological safety, and can be widely applied to the fields of drug delivery, 3D biological printing, medical beauty filling, tissue engineering and the like.

The invention discloses a multi-scale artificial dermal scaffold and a preparation method thereof, and belongs to the technical field of tissue engineering and biomedical materials. The artificial dermal scaffold is of a three-dimensional porous structure formed by microfilaments of a first frame and a second frame, the microfilaments of the second frame are distributed in pores of the first frame, disordered microfilaments which do not affect the penetrability of the macropores are arranged in the macropores in the top surface of the first frame, and longitudinally aligned microfilaments are arranged in the micropores in the section of the first frame. Through the specific structure, the adhesion, proliferation and migration effects of cells can be remarkably improved, and rapid vascularization of artificial dermis is facilitated. In addition, the preparation process of the artificial dermal scaffold is simple and easy to operate, can be used for batch preparation, and has a good application prospect.

This invention belongs to the interdisciplinary field of biomedical engineering, materials science, and tissue engineering, and discloses a multifunctional hydrogel with switchable mechanical and adhesive properties based on temperature triggering, its preparation method, and applications. The invention consists of acrylic acid, gelatin, hexadecyltrimethylammonium bromide, polydopamine nanoparticles loaded with silver nanoparticles, and water. This invention not only exhibits excellent adhesion and mechanical properties to skin tissue but also possesses switchable mechanical and adhesive properties, achieving durable and repeatable adhesion. The temperature-triggered hydrogel prepared by this invention is simple to process, low in cost, and introduces no toxic chemicals. It can achieve a close fit at body temperature and natural detachment at low temperatures, driven by temperature, and maintains excellent adhesion properties even in complex environments, thus promoting the development of intelligent medical multifunctional wound dressings.

The invention belongs to the technical field of bioengineering, and relates to heparan sulfate defect type matrigel as well as a preparation method and application thereof. The preparation method comprises the following steps: providing natural matrigel; providing immobilized heparinase, wherein the immobilized heparinase can specifically catalyze and degrade heparan sulfate in the natural matrigel; carrying out contact reaction on the natural matrigel and the immobilized heparinase; and after the reaction is finished, separating the immobilized heparinase. According to the preparation method, the characteristics that the immobilized enzyme is convenient to separate and recycle are utilized, the problems that in a traditional solution enzyme method, enzyme residues exist, the reaction is difficult to accurately control, and subsequent purification steps are complex are solved, and a standardized heparan sulfate defective matrigel product which is controllable in component, free of residual enzyme and high in stability is provided. The method has wide application value in the fields of tumor mechanism research, anti-tumor drug screening, tissue engineering and the like.

The application belongs to the technical field of genetic engineering and recombinant collagen, and discloses a recombinant human VI type collagen, a coding gene and an expression method thereof, and an amino acid sequence of the recombinant human VI type collagen is shown as SEQ ID NO. 1. The recombinant human VI type collagen provided by the application has good effects of promoting cell proliferation and adhesion, and can protect cells and reduce oxidative stress damage, has a wide application prospect, and can be widely applied to the fields of medicine, medical devices, biological materials, tissue engineering, cosmetics and the like.

A flexible polyvinyl alcohol-polyurethane sponge and its preparation method and application relate to the technical field of polyvinyl alcohol sponges, and solve the problem that the mechanical properties and safety performance of existing polyvinyl alcohol-polyurethane sponges are insufficient. In the present invention, polyethylene glycol and hexamethylene diisocyanate are reacted to obtain an isocyanate-terminated polyurethane prepolymer, which is further reacted with a hydrophilic chain extender dimethylolpropionic acid and a hydroxyl-containing acrylate to prepare a vinyl-functionalized polyurethane and make it into a polyurethane aqueous solution; the polyvinyl alcohol aqueous solution is mixed with the polyurethane aqueous solution, and after being treated by steps such as irradiation and freeze-drying, a flexible polyvinyl alcohol-polyurethane sponge is prepared. The polyvinyl alcohol-polyurethane sponge provided by the present invention has a dense three-dimensional cross-linked network structure, good flexibility, adjustable mechanical properties, high water absorption, and at the same time ensures its application safety in the fields of biomedicine and tissue engineering, meeting the development requirements of green materials.

The invention discloses a metal ion induced alginate aerogel fiber as well as preparation and application thereof. The method comprises the following steps: pre-mixing a sodium alginate solution with a coagulating bath solvent to obtain a uniform spinning solution; extruding the spinning solution into an alcohol coagulating bath through wet spinning to form sodium alginate primary gel fibers; then, introducing the nascent fiber into a calcium ion cross-linking solution with a specific concentration for cross-linking and curing; and finally, drying at normal temperature and normal pressure to obtain the calcium alginate aerogel fiber. The method is simple in process and low in cost, and the obtained fiber has wide application prospects in the fields of adsorption separation, heat insulation, tissue engineering and the like.

Provided herein are anisotropic hydrogels, as well as methods and compositions for synthesizing anisotropic hydrogels, involving a two-stage polymerization and mechanical alignment. The anisotropic hydrogels may encapsulate cells, and can be used in vitro or in vivo for any purpose related to tissue engineering, and regenerative healing, e.g., of the musculoskeletal system.

The application discloses a kind of small molecule compound combination and the method for preparing vascular endothelial cell using the small molecule compound combination induced differentiation cell.The method is directed to induce differentiated cell, and finally prepare vascular endothelial cell;The directional induction includes inhibiting the activity of lysine deacetylase, inhibiting the signal path of TGF-β, inhibiting the activity of DNA methyltransferase (DNMT), activating the signal path of WNT / β-catenin and activating the signal path of cAMP.The present application can be converted into vascular endothelial cell by small molecule compound combination induction, and each step can realize accurate quality control, which is convenient for standardized operation and large-scale production.The method provided by the present application has wide donor sources, and the patient himself can be used as a donor, so that the vascular endothelial cells required for basic research, clinical treatment or tissue engineering production can be obtained in a short time.