Supercharge Your Innovation With Domain-Expert AI Agents!

System and method for enabling the cell apoptosis of chronic myeloid leukaemia

A technology of leukemia cells and chronic granulocytes, applied in botany equipment and methods, biochemical equipment and methods, applications, etc., can solve problems such as imatinib intolerance

Inactive Publication Date: 2014-11-05
CHONGQING MEDICAL UNIVERSITY
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, there are still 1 / 3 patients who are clinically intolerant or resistant to imatinib, and these patients need to seek another alternative therapy

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • System and method for enabling the cell apoptosis of chronic myeloid leukaemia
  • System and method for enabling the cell apoptosis of chronic myeloid leukaemia
  • System and method for enabling the cell apoptosis of chronic myeloid leukaemia

Examples

Experimental program
Comparison scheme
Effect test

Embodiment

[0045] Such as Figure 10 As shown, a system for apoptosis of chronic myelogenous leukemia (CML) cells consists of two fusion peptides N3R loaded with adenovirus, two compounds AP21967 and fusion peptide F2S loaded with adenovirus linked together;

[0046] The fusion peptide N3R is composed of 3 segments connected by NLS and FRB, and the fusion peptide F2S is composed of 2 segments connected by FKBP and SH2,

[0047] A piece of FKBP is combined with a piece of FRB through a compound AP21967; a fusion peptide F2S is combined with two fusion peptides N3R through a compound AP21967;

[0048] The amino acid sequence of the fusion peptide N3R is:

[0049] PKKKRKVPKKKRKVPKKKRKVELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLLQAWDLYYHVFRRISKQ;

[0050] The nucleotide sequence of the fusion peptide N3R is shown in SEQ ID No.1;

[0051] The amino acid sequence of the fusion peptide F2S is:

[0052] MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKF...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a system for enabling the cell apoptosis of chronic myeloid leukaemia. The system is formed by connecting two fusion peptides N3R of an adenovirus vector, two compounds AP21967 and fusion peptide F2S of the adenovirus vector together. Through experimental verification, the system can be used for achieving and realizing induction of CML (Chronic Myeloid Leukemia) cell apoptosis, is good in effect, and has great research values on researching the treatment of leukaemia and developing medicaments.

Description

technical field [0001] The invention belongs to the field of basic medical research, and specifically relates to a system and method for inducing apoptosis of leukemia cells. Background technique [0002] Chronic myeloid leukemia (CML) is a malignant myeloproliferative disease that occurs on early multipotent hematopoietic stem cells. Mainly involving the myeloid system, the clinical manifestations are splenomegaly, significantly increased granulocytes in peripheral blood and immature granulocytes. In affected cell lines, Ph chromosome and / or bcr-abl fusion gene can be found. The Bcr-Abl fusion protein encoded by the bcr-abl fusion gene has constitutively activated tyrosine kinase activity, significantly inhibits cell apoptosis by activating anti-apoptotic signals such as PI3K and STAT5, and induces cell transformation, thereby causing the occurrence of CML develop. The first-line drug currently used clinically in the treatment of CML is imatinib, which blocks the progres...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N15/861
Inventor 冯文莉黄峥兰高淼罗红伟
Owner CHONGQING MEDICAL UNIVERSITY
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com