Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

26 results about "Fusion peptide" patented technology

Peptide Fusion. A superior blend of anti-aging peptides. Our Peptide Fusion Anti-Aging Serum uses a supercharged powerhouse of anti-aging peptides to minimize the look of wrinkles, improve the skin's elasticity and promote a more even, dewy complexion.

Engineered bacteria and methods of use in tumor remodeling

Provided herein is a hypervesiculating Escherichia coli Nissle (ΔECHy) bacterium engineered to produce outer membrane vesicles (OMVs), said OMVs packaging a fusion peptide including cytolysin A (ClyA) and hyaluronidase (Hy). Also provided are methods of remodeling a tumor, methods of treating cancer, and pharmaceutical compositions including the engineered ΔECHy bacterium.
Owner:UNIVERSITY OF CINCINNATI

Cell free vascular grafts and graft materials for cellular recruitment

PendingUS20260097149A1Peptide-nucleic acidsPeptide/protein ingredientsCell freeCell recruitment
The present disclosure relates to an implantable vascular graft material, including: a substrate including a graft material, the substrate defining a top surface and a bottom surface; and one or more bispecific binding partners having a luminal binding domain bound to the top surface and one or more cellular binding domains. In embodiments, the disclosure includes an implantable vascular graft including: a tubular base layer including a graft material, the tubular base layer defining a luminal surface and an abluminal surface; and a fusion peptide having a heparin binding domain bound to the luminal surface and one or more monocyte binding domains. In embodiments, the present disclosure provides one or more implantable vascular grafts such as A-TEVs, methods of making vascular grafts, methods of use, and the like.
Owner:THE RES FOUNDATION FOR THE STATE UNIV OF NEW YORK

Composition containing fusion peptide having tripeptide and biotin bound therein as active ingredient effective for skin whitening, antioxidation, skin condition improvement, hair loss prevention or alleviation, and hair growth promotion

The present invention relates to a composition containing a fusion peptide having tripeptide and biotin bound to each other therein as an active ingredient which is effective for skin whitening, antioxidation, skin condition improvement, hair loss prevention or alleviation, and hair growth promotion. The fusion peptide in which tripeptide and biotin are bound to each other according to the present invention inhibits melanin biosynthesis, promotes cell proliferation, enhances antioxidative activity, and provides effects such as skin whitening, skin regeneration, wound healing, hair loss suppression, and hair growth promotion, and thus can be utilized as a material for cosmetics, pharmaceuticals, and food products.
Owner:BIO FD&C CO LTD

Recombinant bacillus calmette guerin for expressing O and A type multi-epitope fusion peptide of foot and mouth disease virus and application of recombinant bacillus calmette guerin

The invention discloses a recombinant bacillus calmette-guerin vaccine for expressing O and A type multi-epitope fusion peptides of foot and mouth disease viruses and application of the recombinant bacillus calmette-guerin vaccine, and belongs to the field of biotechnology and veterinary vaccines. The amino acid sequence of the multi-epitope fusion peptide is shown as SEQ ID NO: 1, the multi-epitope fusion peptide comprises dominant immune T cell and B cell antigen epitopes from a plurality of O-type and A-type foot-and-mouth disease virus epidemic strains, and a mycobacterium signal peptide is fused at the N terminal. The recombinant strain rBCG-MIPGA is successfully constructed by carrying out codon optimization on the fusion gene, cloning the fusion gene to a pMV306 vector and carrying out electrotransfection on BCG. The recombinant BCG can simultaneously excite high-titer specific antibodies aiming at foot-and-mouth disease virus type O and type A and remarkable T cell immune response, shows lasting and broad-spectrum protection potential, and has great application value in the aspect of preparing safe, efficient and broad-spectrum foot-and-mouth disease vaccines.
Owner:HUAZHONG AGRI UNIV +1

Screening and fermentation preparation method of high-yield antibacterial peptide probiotics

PendingCN121674446ABacteriaAnimal feeding stuffBiotechnologyPeptide secretion
The invention discloses a screening and fermentation preparation method of high-yield antibacterial peptide probiotics, and relates to the technical field of microbial fermentation and animal nutrition, the method comprises three core steps of intestinal colonization-oriented multi-phenotype collaborative screening, self-assembled antibacterial peptide engineering bacterium construction, and in-situ nanocrystallization fermentation preparation. The preparation method comprises the following steps: firstly, screening out a probiotic host with gastrointestinal tolerance, colonization capability and self-assembly precursor peptide secretion potential, then constructing a fusion gene engineering bacterium containing an intestinal environment induced promoter, and finally, performing staged fermentation to realize fusion peptide in-situ self-assembly and spray drying to obtain a finished product, and the finished product contains colonization type recombinant viable bacteria and antibacterial peptide nanoparticles. The method can realize targeted colonization and long-acting bacteriostasis of intestinal tracts, has application stability and efficacy persistence, and is suitable for production of feed antibacterial peptide preparations.
Owner:HENAN BUSINESS SCI RES INST

Fusion peptide, polynucleotide encoding same, and use therefor

PCT designated stageWO2026134106A1FungiBacteriaCarboxyl radicalPolynucleotide
The present invention relates to a fusion peptide, a salt thereof, or a solvate thereof, the fusion peptide containing, from the amino terminus toward the carboxy terminus, a tag peptide and any peptide among (A1)-(A3). (A1) A peptide that comprises the amino acid sequence represented by SEQ ID NO: 1; (A2) a peptide that comprises an amino acid sequence obtained by deleting, substituting, or adding 1-4 amino acids in the amino acid sequence represented by SEQ ID NO: 1 and that has a pore density increasing effect; and (A3) a peptide that comprises an amino acid sequence having 90% or more sequence identity with the amino acid sequence represented by SEQ ID NO: 1 and that has a pore density increasing effect.
Owner:SANYO CHEM IND LTD

Inducible immunomodulating tumor-homing bacteria

A recombinant tumor-homing bacterium having constitutive prokaryotic expression cassettes comprising two or more homologous cancer associated antigens, each of the respective homologous cancer associated antigens associated with a transport signal from a distinct transport system, a regulating expression cassette encoding a regulator and an aspirin-inducible prokaryotic expression cassette encoding a set of immunomodulator fusion peptides operably linked to an inducible promoter, each of said immunomodulator fusion peptides comprising a heterologous immunomodulator associated with a secretion signal, said heterologous immunomodulator selected from a list consisting of: LIGHT, GMCSF, SIRP alpha, and IL18.
Owner:BACCINE LTD +1

Oral cancer marker linear epitope fusion peptide and its application

The present invention discloses an oral cancer marker linear epitope fusion peptide and an application thereof. The oral cancer marker linear epitope fusion peptide comprises a fusion peptide 1 and a fusion peptide 2; the nucleotide sequence of the fusion peptide 1 is: SKDQIKKLTSLKNKLERRQNRSQNPVQPIGPQTPKACDSK; the nucleotide sequence of the fusion peptide 2 is: SKDQIKKLTSLKNKLERRQNEDERWTNNFREYNL; the oral cancer marker linear epitope fusion peptide can be fused with a T cell epitope to promote the occurrence of an immune response. The generated antiserum has high affinity and specificity, laying a good foundation for the further preparation of high-affinity monoclonal antibodies and the development of detection kits. The fusion peptide 1 and the fusion peptide 2 can replace the full-length MMP-1 as a calibrator of the detection kit through chemical coupling treatment.
Owner:NINGBO BEILUN STOMATOLOGICAL HOSPITAL GROUP CO LTD

Polymer protein nanoparticle and application thereof in preparation of novel coronavirus broad-spectrum vaccine

The invention discloses a polymer protein nanoparticle and application thereof in preparation of a novel coronavirus broad-spectrum vaccine, and the polymer protein nanoparticle is prepared by forming a pentamer compound FP-HR5 fusion protein by using heptapeptide repeat regions HR1 and HR2 and a fusion peptide FP on a coronavirus S protein, and on the basis, assembling with Ferritin to obtain the polymer protein nanoparticle. And preparing the novel coronavirus antigen polymer compound FP-HR5-NP protein nanoparticles. The novel coronavirus universal nanoparticle vaccine which can be inoculated through injection or a respiratory system and has a good immune protection effect is prepared by taking the coronavirus as an immunogen. The obtained novel coronavirus vaccine is good in immune protection effect, mucosal immunity can be remarkably activated after a respiratory system is inoculated, infection of novel coronaviruses of different mutant strains can be avoided after the respiratory system is inoculated, the preparation method is simple, the protein expression and purification technical route is mature, safety is high, and the novel coronavirus vaccine can be rapidly applied to clinical tests.
Owner:SUN YAT SEN UNIV

An antiallergic pharmaceutical composition, a preparation method thereof, and use thereof

This invention discloses a fusion peptide with synergistic anti-allergic effects, an anti-LTB4 monoclonal antibody, and an anti-allergic drug composition thereof. The fusion peptide is composed of peptide A, which inhibits histamine release, and peptide B, which blocks mast cell activation signals, covalently linked by a linker peptide, which can synergistically inhibit mast cell activation. The anti-LTB4 monoclonal antibody can specifically bind to LTB4, blocking its mediated inflammatory response. Combining the fusion peptide, the anti-LTB4 monoclonal antibody, and myricetin, which has antioxidant activity, forms a multi-target drug composition that can synergistically inhibit allergic reactions from multiple aspects, such as inhibiting mast cell degranulation, blocking the action of inflammatory mediators, and clearing oxidative stress products. In vitro cell experiments and OVA-induced allergic asthma mouse models have demonstrated that the anti-allergic effect of this composition is significantly better than that of a single component, and it has no obvious toxicity, providing a new candidate drug for the efficient treatment of allergic diseases.
Owner:GUANGZHOU AOQI BIOTECHNOLOGY CO LTD

Application of TAT-Pi4KII alpha fusion peptide in preparation of medicine for treating neurocognitive impairment

The invention discloses an application of a TAT-Pi4KII alpha fusion peptide in preparation of a medicine for treating neurocognitive impairment. The TAT-Pi4KII alpha fusion peptide disclosed by the invention is as shown in SEQ ID No. 1 (sequence identifier number 1). Experiments prove that the TAT-Pi4KII alpha fusion peptide disclosed by the invention can relieve learning ability impairment, memory function impairment and space exploration cognitive ability impairment of animals with neurocognitive impairment. The TAT-Pi4KII alpha fusion peptide disclosed by the invention is used as an active ingredient for preparing a medicine for treating neurocognitive impairment, and has the advantages of quick effect, good curative effect and small side effect. The invention has great application value in treatment of neurocognitive impairment.
Owner:PEKING UNIV SHENZHEN GRADUATE SCHOOL

A polypeptide capable of orientable enhancement of thymic neotrans T cells in inhibiting melanoma and application thereof

The application discloses a polypeptide capable of directionally enhancing thymus newborn T cells to inhibit melanoma and application thereof, and a peptide segment sequence of the polypeptide is NH2-FNNFTVSFWLRVPKVSASHL-GPSL-KDMQLGR-CONH2. A Th cell epitope sequence (FNNFTVSFWLRVPKVSASHL) is from a tetanus toxoid 947-967 peptide segment (TT3), and a four-residue linker (GPSL) is arranged after the T cell epitope. The linker is integrated into a fusion peptide to help independent folding of the T cell epitope and a B cell epitope. A B cell epitope sequence is a C segment fragment (KDMQLGR) of C5a. The polypeptide of the application can inhibit melanoma growth, enhance thymus newborn T cell function, has low toxicity and side effects, and can be applied to melanoma treatment, thereby providing a new scheme and a new idea for melanoma treatment.
Owner:ARMY MEDICAL UNIV

An antiviral fusion peptide with the effect of inhibiting BPIV3 and BoHV-1 infection and its application

The present invention discloses an antiviral fusion peptide and its application with the effect of inhibiting BPIV3 and BoHV-1 infection. The antiviral fusion peptide is obtained by fusing TAT membrane-penetrating peptide with bovine Viperin (BoViperin) protein. The present invention confirms that overexpression of BoViperin protein in bovine cells can inhibit the replication of BPIV3 and BoHV-1; TAT membrane-penetrating peptide mediates BoViperin protein and can be transduced into bovine cells and mouse lungs, which can inhibit the replication of BPIV3 and BoHV-1, indicating that BoViperin protein can quickly establish an antiviral infection state at the cellular level and animal level. The present invention confirms that the antiviral fusion peptide obtained by fusing TAT membrane-penetrating peptide with BoViperin has the advantages of simple preparation and convenient delivery, and can lay the foundation for the development of efficient and broad-spectrum cattle antiviral drugs.
Owner:NORTHEAST AGRICULTURAL UNIVERSITY

Recombinant bacillus calmette-guerin expressing foot-and-mouth disease virus o, a type multi-epitope fusion peptide and application thereof

This invention discloses a recombinant BCG vaccine expressing a multi-epitope fusion peptide of foot-and-mouth disease virus (FMD) types O and A and its application, belonging to the fields of biotechnology and veterinary vaccines. The amino acid sequence of the multi-epitope fusion peptide is shown in SEQ ID NO:1, containing dominant immune T-cell and B-cell antigenic epitopes from multiple circulating FMD virus types O and A, and fused with a mycobacterial signal peptide at the N-terminus. This invention successfully constructed the recombinant strain rBCG-MIPGA by codon optimization of the fusion gene, cloning it into the pMV306 vector, and electroporating it into BCG. This recombinant BCG can simultaneously stimulate high-titer specific antibodies and significant T-cell immune responses against FMD virus types O and A, exhibiting durable and broad-spectrum protective potential, and has significant application value in the preparation of safe, efficient, and broad-spectrum FMD vaccines.
Owner:HUAZHONG AGRI UNIV +1

Pharmaceutical composition for treating allergic conjunctivitis in children, and preparation method and use thereof

This invention belongs to the field of biomedical technology, specifically relating to a pharmaceutical composition for treating allergic conjunctivitis in children, its preparation method, and its uses. The pharmaceutical composition of this invention comprises hsa-miR-19b mimic and an immune peptide, wherein the immune peptide is a fusion peptide NGF-FGF, a combination of nerve growth factor (NGF) and fibroblast growth factor (FGF). In vitro and in vivo experiments have confirmed that hsa-miR-19b mimic and the fusion peptide NGF-FGF can alleviate the course of allergic conjunctivitis in children and reduce allergic symptoms by inhibiting the expression of inflammatory factors and reducing inflammatory responses.
Owner:CHANGCHUN UNIV OF CHINESE MEDICINE

Protein-based advanced wound healing system

A novel composition and method of enhancing wound healing and minimizing rejection of an implant is presented. The composition is a dry acellular mixture comprised of conditioned media from mesenchymal stem cells, a multifunctional protease inhibitor, and a tethering peptide that acts as a tether to keep the composition in contact with the targeted area. An antimicrobial fusion peptide may also be added to the composition.
Owner:UNIV OF SOUTH FLORIDA

HLA gene modified cell

Provided is a cell having improved tissue compatibility with a transplantation subject. Specifically, by knocking a polynucleotide encoding a single-chain fusion peptide that mimics HLA-G and / or HLA-E that has an inhibitory effect on the activity (cell damage) of NK cells and macrophages into a region encoding the alpha chain of an HLA class I molecule, it is possible to inhibit the expression of the alpha chain of the HLA class I molecule while expressing the single-chain fusion peptide.
Owner:AJINOMOTO CO INC +1

A polypeptide capable of orientable enhancement of thymic naive t cell killing of breast cancer and applications thereof

The application discloses a polypeptide capable of directionally enhancing thymus newborn T cells to kill breast cancer and application thereof, and a peptide segment sequence is NH2-KLLSLIKGVIVHRLEGVE-GPSL-KDMQLGR-CONH2. A Th cell epitope sequence (KLLSLIKGVIVHRLEGVE) is from a measles virus fusion protein 288-302 peptide segment (MVF), and a four-residue linker (GPSL) is behind the T cell epitope. The linker is integrated into the fusion peptide to help independent folding of the T cell epitope and a B cell epitope. A B cell epitope sequence is a C segment fragment (KDMQLGR) of C5a. The polypeptide of the application can inhibit breast cancer tumor growth, enhance thymus T cell function output, and enhance T cell directional killing function on breast cancer, has low toxic side effects, and can be applied to breast cancer treatment, thereby providing a new scheme and a new idea for breast cancer treatment.
Owner:ARMY MEDICAL UNIV

Multi-epitope peptide of Ebola virus, vaccine as well as preparation method and application of multi-epitope peptide and vaccine

The invention discloses a multi-epitope peptide of Ebola virus, a vaccine as well as a preparation method and application of the multi-epitope peptide and the vaccine, and belongs to the technical field of biological medicines. The multi-epitope peptide is derived from surface glycoprotein (Glycoprotein, GP) of Zaire type Ebola virus and Sudan type Ebola virus, and the epitope peptide is conserved in the two types of Ebola viruses. In addition, the multi-epitope peptide is both a T cell epitope and a B cell epitope. An epitope peptide and a nano delivery carrier are connected through a linker to prepare a vaccine, the vaccine comprises the multi-epitope peptide or a combination thereof, a free KFE8 self-assembly peptide and a PADRE-KFE8 fusion peptide, and a nano fiber structure is formed through self-assembly of the multi-epitope peptide or the combination thereof, the free KFE8 self-assembly peptide and the PADRE-KFE8 fusion peptide. The preparation method comprises the following steps: dissolving the components in a buffer solution according to a specific molar ratio, and incubating to enable the components to be self-assembled to form nanofibers. The multi-epitope peptide can be used for preparing a vaccine for preventing Ebola virus infection, and the vaccine can induce humoral immunity and cellular immunity at the same time, and has broad-spectrum protection potential for Zaire type and Sudan type Ebola viruses at the same time.
Owner:FOURTH MILITARY MEDICAL UNIVERSITY

Polypeptide-drug conjugate (PDC) nano prodrug with function of repairing pericerebral cells

The invention belongs to the technical field of pharmaceutical preparations, relates to a PDC (Polycrystalline Diamond Compact) nano prodrug with a function of repairing pericerebral cells, and in particular relates to a polypeptide-drug conjugate (PDC) nano prodrug with a function of repairing pericerebral cells as well as a preparation method and application thereof. The PDC nano prodrug is formed by coupling a fusion peptide and a polyphenol drug through a phenylboronic acid ester bond and further self-assembling, and the PDC nano prodrug has the advantages that preparation is simple, only water bath ultrasonic treatment is needed, and production amplification is easy; the material-free co-loading of the polypeptide and the small molecule medicine can be realized, the potential toxicity of a carrier material is avoided, and meanwhile, the medicine loading capacity is greatly improved; precise delivery and response release of a focus part are realized, and a complex pathological mechanism of brain diseases is regulated and controlled in multiple links; a more economical and effective treatment mode can be provided for prevention and treatment of related brain diseases, and the application prospect is wide.
Owner:FUDAN UNIVERSITY

Method for identifying breast cancer prognosis fusion gene target and antigen candidate and application

The invention provides a method for identifying a breast cancer prognosis fusion gene target and an antigen candidate and application. The method comprises the following steps: extracting a fusion gene existing in a breast cancer patient, evaluating the prognosis of the patient, and providing a panorama of the prognosis fusion gene in the breast cancer patient; identifying a fusion protein from the fusion gene, generating a full-length fusion protein sequence, and annotating a functional structure domain; extracting a fusion peptide from the fusion protein, predicting the combination of the fusion peptide and the HLA antigen, and forming an immunotherapy candidate library of the breast cancer neoantigen; the binding site of the breast cancer neoantigen and the MHC molecule is predicted, and the reliability of the breast cancer neoantigen is verified. The fusion protein is recognized from the fusion gene, the fusion peptide is extracted, the new antigen candidate of the BRCA is predicted through high-throughput artificial intelligence calculation, a new target spot is provided for cancer immunodetection, the new antigen candidate can be used as a potential predictive factor for tumor survival prognosis and immune checkpoint response, and a new way is provided for personalized medical treatment and immunodetection.
Owner:BEIJING YUANGE TECHNOLOGY CO LTD

Application of CMA targeted fusion peptide, cosmetics and culture medium

The invention relates to the technical field of polypeptides, and discloses an application of a CMA targeted fusion peptide, a cosmetic and a culture medium. The CMA targeted fusion peptide is a CT4 fusion peptide, the amino acid sequence of the CMA targeted fusion peptide is YGRKRRQRRR FLYRWLPSRRGG KFERQKILDQRFFE, and the CMA targeted fusion peptide is applied to the field of cosmetics, can be used for preparing cosmetics for reducing melanin deposition, improving skin apparent brightness and reducing the secretion amount of inflammatory factors, and improves oxidative damage of keratinocytes caused by UVB by reducing the content of active oxygen; the method is applied to the technical field of culture media and can adjust the protein secretion amount of cells.
Owner:BAOXIN ASIA PACIFIC BIOTECH SHENZHEN CO LTD

Immune T cell preparation and application thereof in tumor treatment

The invention provides an immune T cell preparation and application thereof in tumor treatment, and belongs to the technical field of cell biology. According to the method, human peripheral blood CD8 positive T cells are used as starting cells, and sequence-improved fusion peptide DerB-MA-1 is used for in-vitro induction. Experimental results show that T cells pretreated by DerB-MA-1 show extremely high killing activity under a normal oxygen condition, and the killing activity is remarkably superior to that of other fusion peptides. More importantly, under the hypoxia condition of simulating the tumor microenvironment, the preparation c can still maintain the potent killing rate. Therefore, the invention successfully overcomes the technical bottleneck of function decline of T cells in an anoxic environment, realizes obvious breakthrough of T cell functions, and has important clinical application value in immune cell therapy of solid tumors such as melanoma and the like.
Owner:ZHONGZHEN (SHENZHEN) BIOMEDICAL RES CO LTD

Respiratory syncytial virus mutants, fusion peptides, particles, nucleic acids, pharmaceutical compositions and methods of use

Disclosed herein are compositions and methods for controlling respiratory syncytial virus (RSV) infection. In certain embodiments, vaccines and pharmaceutical compositions comprise or encode RSV G proteins comprising the mutations or fusion protein arrangements disclosed herein. In certain embodiments, viral particles / virus-like particles, nucleic acids, vectors, or attenuated RSV vaccines are used in the methods reported herein.
Owner:EMORY UNIVERSITY +1