50 results about "Fusion peptide" patented technology

The invention provides an infectious bronchitis virus antigen epitope fusion peptide, and the prepared antigen epitope fusion peptide can be used for preparing an antibody and can also be used as a coating antigen for preparing an indirect ELISA detection product. The amino acid sequence of the provided epitope fusion peptide is SEQ ID NO: 4. After antigen epitope analysis is performed on S1 protein of an infectious bronchitis virus strain through bioinformatics software, a plurality of antigen epitopes are fused to obtain the antigen epitope fusion peptide. Specificity tests show that the prepared antigen epitope fusion peptide is a coating antigen, does not have cross reaction with positive serum of other common pathogens, and only has good reaction with positive serum of GI-19 type IBV, that is, the antigen epitope fusion peptide has good serotype specificity as a detection antigen, and has small cross reaction with non-GI-19 type IBV antibody.

The invention belongs to the technical field of biological medicine, and provides a multifunctional fusion peptide modified 3D printing Ti implant constructed by a fusion peptide platform and a preparation method and application thereof. The antibacterial peptide KR-12 and the adhesion peptide GFOGER are simultaneously loaded on the surface of the 3D printing titanium implant through the specific targeting peptide minTBP-1. The sequence of the fusion peptide platform is divided into four main components: bioactive polypeptide sequences KR-12 and GFOGER; a connection unit (Linker); a lysine residue; a specific anchoring group minTBP-1; the composite material has specific loading and slow release capabilities, and utilizes synergistic antibacterial and osteogenesis functions to cope with continuous challenges of implant infection and insufficient osseointegration in biomedical equipment. Meanwhile, sterilization and bone regeneration promotion are achieved, and the method is of great importance to bone healing and enhancement of bone combination around the implant. In addition to the antibacterial effect, the synergistic effect of the antibacterial peptide KR-12 and the adhesive peptide GFOGER can significantly promote osteogenesis of the BMSCs.

Provided herein is a hypervesiculating Escherichia coli Nissle (ΔECHy) bacterium engineered to produce outer membrane vesicles (OMVs), said OMVs packaging a fusion peptide including cytolysin A (ClyA) and hyaluronidase (Hy). Also provided are methods of remodeling a tumor, methods of treating cancer, and pharmaceutical compositions including the engineered ΔECHy bacterium.

Compositions and methods for improved ACT are provided. Compositions of CAR-T cells including CAR modified by fusion with one or more copies of a polypeptide including from 20 to 44 amino acids from the transmembrane and / or cytosolic domain of CTLA-4 (CT) are described. CAR-CT-T cells have reduced trogocytosis, reduced T-cell fratricide, enhanced tumor antigen presentation and overall enhanced anti-tumor efficacy as compared with CAR-T cells lacking the CT domain(s). In preferred embodiments, CAR-TC fusion peptides include a CT domain having 2 copies of the YVKM motif. The compositions and methods provide enhanced CAR-T cell therapy for cancer, auto-immune disease as well as other disease and disorders. Also disclosed are genetically modified cells and pharmaceutical compositions and methods of use thereof for treating subjects having diseases or disorders.

The present invention relates to the field of biological medicines. Disclosed are a fusion adeno-associated virus and a use thereof in otological disease and ophthalmic diseases. The fusion adeno-associated virus comprises a fusion peptide fragment formed by fusion of peptide fragments of serotypes AAV1, AAV2, AAV6 and AAV7, or a variant thereof, and can efficiently infect an RPE layer for the treatment of ophthalmic diseases. The fusion adeno-associated virus has a wide application prospect in the treatment of ophthalmic diseases as a safe vector.

The present disclosure relates to an implantable vascular graft material, including: a substrate including a graft material, the substrate defining a top surface and a bottom surface; and one or more bispecific binding partners having a luminal binding domain bound to the top surface and one or more cellular binding domains. In embodiments, the disclosure includes an implantable vascular graft including: a tubular base layer including a graft material, the tubular base layer defining a luminal surface and an abluminal surface; and a fusion peptide having a heparin binding domain bound to the luminal surface and one or more monocyte binding domains. In embodiments, the present disclosure provides one or more implantable vascular grafts such as A-TEVs, methods of making vascular grafts, methods of use, and the like.

The present invention relates to a composition containing a fusion peptide having tripeptide and biotin bound to each other therein as an active ingredient which is effective for skin whitening, antioxidation, skin condition improvement, hair loss prevention or alleviation, and hair growth promotion. The fusion peptide in which tripeptide and biotin are bound to each other according to the present invention inhibits melanin biosynthesis, promotes cell proliferation, enhances antioxidative activity, and provides effects such as skin whitening, skin regeneration, wound healing, hair loss suppression, and hair growth promotion, and thus can be utilized as a material for cosmetics, pharmaceuticals, and food products.

The invention discloses a recombinant bacillus calmette-guerin vaccine for expressing O and A type multi-epitope fusion peptides of foot and mouth disease viruses and application of the recombinant bacillus calmette-guerin vaccine, and belongs to the field of biotechnology and veterinary vaccines. The amino acid sequence of the multi-epitope fusion peptide is shown as SEQ ID NO: 1, the multi-epitope fusion peptide comprises dominant immune T cell and B cell antigen epitopes from a plurality of O-type and A-type foot-and-mouth disease virus epidemic strains, and a mycobacterium signal peptide is fused at the N terminal. The recombinant strain rBCG-MIPGA is successfully constructed by carrying out codon optimization on the fusion gene, cloning the fusion gene to a pMV306 vector and carrying out electrotransfection on BCG. The recombinant BCG can simultaneously excite high-titer specific antibodies aiming at foot-and-mouth disease virus type O and type A and remarkable T cell immune response, shows lasting and broad-spectrum protection potential, and has great application value in the aspect of preparing safe, efficient and broad-spectrum foot-and-mouth disease vaccines.

According to the double-expression protein particle provided by the invention, a target fragment of the double-expression protein particle comprises TNFSF14 and / or anti-CD3 svFc, and the target fragment of the double-expression protein particle comprises TNFSF14 and / or anti-CD3 svFc; the nucleotide sequence of the TNFSF14 is as shown in SEQ ID NO: 2; the nucleotide sequence of the anti-CD3 svFc is as shown in SEQ ID NO: 3; and / or a nucleotide sequence which has the homology of 90%-100% with the nucleotide sequence of the target fragment and is used for coding protein with the same function. By constructing a multi-target fragment with a specific sequence, a fusion peptide and a specific fusion mode, double-expression protein plasmids are formed, infiltration and penetration of T cells to a tumor microenvironment can be increased, and the T cells are combined with enhancement of the activity of the T cells, so that the anti-tumor capability of the T cells is enhanced.

The invention discloses a screening and fermentation preparation method of high-yield antibacterial peptide probiotics, and relates to the technical field of microbial fermentation and animal nutrition, the method comprises three core steps of intestinal colonization-oriented multi-phenotype collaborative screening, self-assembled antibacterial peptide engineering bacterium construction, and in-situ nanocrystallization fermentation preparation. The preparation method comprises the following steps: firstly, screening out a probiotic host with gastrointestinal tolerance, colonization capability and self-assembly precursor peptide secretion potential, then constructing a fusion gene engineering bacterium containing an intestinal environment induced promoter, and finally, performing staged fermentation to realize fusion peptide in-situ self-assembly and spray drying to obtain a finished product, and the finished product contains colonization type recombinant viable bacteria and antibacterial peptide nanoparticles. The method can realize targeted colonization and long-acting bacteriostasis of intestinal tracts, has application stability and efficacy persistence, and is suitable for production of feed antibacterial peptide preparations.

The present invention relates to a fusion peptide, a salt thereof, or a solvate thereof, the fusion peptide containing, from the amino terminus toward the carboxy terminus, a tag peptide and any peptide among (A1)-(A3). (A1) A peptide that comprises the amino acid sequence represented by SEQ ID NO: 1; (A2) a peptide that comprises an amino acid sequence obtained by deleting, substituting, or adding 1-4 amino acids in the amino acid sequence represented by SEQ ID NO: 1 and that has a pore density increasing effect; and (A3) a peptide that comprises an amino acid sequence having 90% or more sequence identity with the amino acid sequence represented by SEQ ID NO: 1 and that has a pore density increasing effect.

A recombinant tumor-homing bacterium having constitutive prokaryotic expression cassettes comprising two or more homologous cancer associated antigens, each of the respective homologous cancer associated antigens associated with a transport signal from a distinct transport system, a regulating expression cassette encoding a regulator and an aspirin-inducible prokaryotic expression cassette encoding a set of immunomodulator fusion peptides operably linked to an inducible promoter, each of said immunomodulator fusion peptides comprising a heterologous immunomodulator associated with a secretion signal, said heterologous immunomodulator selected from a list consisting of: LIGHT, GMCSF, SIRP alpha, and IL18.

The present invention discloses an oral cancer marker linear epitope fusion peptide and an application thereof. The oral cancer marker linear epitope fusion peptide comprises a fusion peptide 1 and a fusion peptide 2; the nucleotide sequence of the fusion peptide 1 is: SKDQIKKLTSLKNKLERRQNRSQNPVQPIGPQTPKACDSK; the nucleotide sequence of the fusion peptide 2 is: SKDQIKKLTSLKNKLERRQNEDERWTNNFREYNL; the oral cancer marker linear epitope fusion peptide can be fused with a T cell epitope to promote the occurrence of an immune response. The generated antiserum has high affinity and specificity, laying a good foundation for the further preparation of high-affinity monoclonal antibodies and the development of detection kits. The fusion peptide 1 and the fusion peptide 2 can replace the full-length MMP-1 as a calibrator of the detection kit through chemical coupling treatment.

The invention discloses a polymer protein nanoparticle and application thereof in preparation of a novel coronavirus broad-spectrum vaccine, and the polymer protein nanoparticle is prepared by forming a pentamer compound FP-HR5 fusion protein by using heptapeptide repeat regions HR1 and HR2 and a fusion peptide FP on a coronavirus S protein, and on the basis, assembling with Ferritin to obtain the polymer protein nanoparticle. And preparing the novel coronavirus antigen polymer compound FP-HR5-NP protein nanoparticles. The novel coronavirus universal nanoparticle vaccine which can be inoculated through injection or a respiratory system and has a good immune protection effect is prepared by taking the coronavirus as an immunogen. The obtained novel coronavirus vaccine is good in immune protection effect, mucosal immunity can be remarkably activated after a respiratory system is inoculated, infection of novel coronaviruses of different mutant strains can be avoided after the respiratory system is inoculated, the preparation method is simple, the protein expression and purification technical route is mature, safety is high, and the novel coronavirus vaccine can be rapidly applied to clinical tests.

This invention discloses a fusion peptide with synergistic anti-allergic effects, an anti-LTB4 monoclonal antibody, and an anti-allergic drug composition thereof. The fusion peptide is composed of peptide A, which inhibits histamine release, and peptide B, which blocks mast cell activation signals, covalently linked by a linker peptide, which can synergistically inhibit mast cell activation. The anti-LTB4 monoclonal antibody can specifically bind to LTB4, blocking its mediated inflammatory response. Combining the fusion peptide, the anti-LTB4 monoclonal antibody, and myricetin, which has antioxidant activity, forms a multi-target drug composition that can synergistically inhibit allergic reactions from multiple aspects, such as inhibiting mast cell degranulation, blocking the action of inflammatory mediators, and clearing oxidative stress products. In vitro cell experiments and OVA-induced allergic asthma mouse models have demonstrated that the anti-allergic effect of this composition is significantly better than that of a single component, and it has no obvious toxicity, providing a new candidate drug for the efficient treatment of allergic diseases.

The invention discloses an application of a TAT-Pi4KII alpha fusion peptide in preparation of a medicine for treating neurocognitive impairment. The TAT-Pi4KII alpha fusion peptide disclosed by the invention is as shown in SEQ ID No. 1 (sequence identifier number 1). Experiments prove that the TAT-Pi4KII alpha fusion peptide disclosed by the invention can relieve learning ability impairment, memory function impairment and space exploration cognitive ability impairment of animals with neurocognitive impairment. The TAT-Pi4KII alpha fusion peptide disclosed by the invention is used as an active ingredient for preparing a medicine for treating neurocognitive impairment, and has the advantages of quick effect, good curative effect and small side effect. The invention has great application value in treatment of neurocognitive impairment.

The present invention relates to a cell-penetrating repeating peptide in which a plurality of cell-penetrating peptides are repeatedly linked, and has been completed by confirming that the cell-penetrating repeating peptide has significantly higher cell permeability than a single peptide, and thus can enhance the efficiency of intracellular transport of a conjugated protein. Thus, a neurotransmitter secretion-blocking peptide conjugated to the cell-penetrating repeating peptide, of the present invention, can move into cells with high efficiency, and thus can more effectively block the secretion of neurotransmitters by cells. Therefore, the neurotransmitter secretion-blocking peptide can be used not only for cosmetic purposes such as improving skin wrinkles, but also for ameliorating or treating neuromuscular diseases caused by excessive neuronal signal transduction, muscle tension, and the like.

Disclosed are coronavirus-based immunogens, including immunogens comprising spike protein and or domains thereof, comprised in immunogen displays (e.g., nanoparticles). Provided are also immunogenic compositions and methods of using these immunogens to induce immunogenic responses in a subject.

The application discloses a polypeptide capable of directionally enhancing thymus newborn T cells to inhibit melanoma and application thereof, and a peptide segment sequence of the polypeptide is NH2-FNNFTVSFWLRVPKVSASHL-GPSL-KDMQLGR-CONH2. A Th cell epitope sequence (FNNFTVSFWLRVPKVSASHL) is from a tetanus toxoid 947-967 peptide segment (TT3), and a four-residue linker (GPSL) is arranged after the T cell epitope. The linker is integrated into a fusion peptide to help independent folding of the T cell epitope and a B cell epitope. A B cell epitope sequence is a C segment fragment (KDMQLGR) of C5a. The polypeptide of the application can inhibit melanoma growth, enhance thymus newborn T cell function, has low toxicity and side effects, and can be applied to melanoma treatment, thereby providing a new scheme and a new idea for melanoma treatment.

The present invention discloses an antiviral fusion peptide and its application with the effect of inhibiting BPIV3 and BoHV-1 infection. The antiviral fusion peptide is obtained by fusing TAT membrane-penetrating peptide with bovine Viperin (BoViperin) protein. The present invention confirms that overexpression of BoViperin protein in bovine cells can inhibit the replication of BPIV3 and BoHV-1; TAT membrane-penetrating peptide mediates BoViperin protein and can be transduced into bovine cells and mouse lungs, which can inhibit the replication of BPIV3 and BoHV-1, indicating that BoViperin protein can quickly establish an antiviral infection state at the cellular level and animal level. The present invention confirms that the antiviral fusion peptide obtained by fusing TAT membrane-penetrating peptide with BoViperin has the advantages of simple preparation and convenient delivery, and can lay the foundation for the development of efficient and broad-spectrum cattle antiviral drugs.

This invention discloses a recombinant BCG vaccine expressing a multi-epitope fusion peptide of foot-and-mouth disease virus (FMD) types O and A and its application, belonging to the fields of biotechnology and veterinary vaccines. The amino acid sequence of the multi-epitope fusion peptide is shown in SEQ ID NO:1, containing dominant immune T-cell and B-cell antigenic epitopes from multiple circulating FMD virus types O and A, and fused with a mycobacterial signal peptide at the N-terminus. This invention successfully constructed the recombinant strain rBCG-MIPGA by codon optimization of the fusion gene, cloning it into the pMV306 vector, and electroporating it into BCG. This recombinant BCG can simultaneously stimulate high-titer specific antibodies and significant T-cell immune responses against FMD virus types O and A, exhibiting durable and broad-spectrum protective potential, and has significant application value in the preparation of safe, efficient, and broad-spectrum FMD vaccines.

The present disclosure relates to a peptide for inhibiting PPI between IP3R and GRP75 in MAM, and a composition for preventing, alleviating or treating a disease related to autophagy disorder containing the same as an active ingredient.The features and advantages of the present disclosure may be summarized as follows:(a) The present disclosure provides a peptide capable of inducing intracellular autophagy by inhibiting the interaction between the endoplasmic reticulum and mitochondria, more specifically the PPI between IP3R and GRP75 in MAM, by regulating the activity of MAM.(b) The peptide of the present disclosure can be usefully applied to alleviate or treat a disease related to autophagy disorder, especially a disease caused by abnormal protein accumulation induced by reduced intracellular autophagy or a degenerative disease.

The present invention includes conjugates comprising a glucagon-like peptide 1 (GLP-1) fusion peptide coupled to a cyclic PYY peptide. The present invention also relates to pharmaceutical compositions and methods of use thereof. The novel conjugates can be used to prevent, treat or ameliorate the diseases and disorders disclosed herein.

This invention belongs to the field of biomedical technology, specifically relating to a pharmaceutical composition for treating allergic conjunctivitis in children, its preparation method, and its uses. The pharmaceutical composition of this invention comprises hsa-miR-19b mimic and an immune peptide, wherein the immune peptide is a fusion peptide NGF-FGF, a combination of nerve growth factor (NGF) and fibroblast growth factor (FGF). In vitro and in vivo experiments have confirmed that hsa-miR-19b mimic and the fusion peptide NGF-FGF can alleviate the course of allergic conjunctivitis in children and reduce allergic symptoms by inhibiting the expression of inflammatory factors and reducing inflammatory responses.

Provided herein are methods, compositions, kits, and systems for modulating peptide function. In particular, provided herein are methods, compositions, kits, and systems comprising a nucleic acid construct and a fusion protein comprising a chemically activated protein domain (CAP) that modulates the activity of a fusion peptide in the presence of a ligand.

A novel composition and method of enhancing wound healing and minimizing rejection of an implant is presented. The composition is a dry acellular mixture comprised of conditioned media from mesenchymal stem cells, a multifunctional protease inhibitor, and a tethering peptide that acts as a tether to keep the composition in contact with the targeted area. An antimicrobial fusion peptide may also be added to the composition.

Provided is a cell having improved tissue compatibility with a transplantation subject. Specifically, by knocking a polynucleotide encoding a single-chain fusion peptide that mimics HLA-G and / or HLA-E that has an inhibitory effect on the activity (cell damage) of NK cells and macrophages into a region encoding the alpha chain of an HLA class I molecule, it is possible to inhibit the expression of the alpha chain of the HLA class I molecule while expressing the single-chain fusion peptide.

The application discloses a polypeptide capable of directionally enhancing thymus newborn T cells to kill breast cancer and application thereof, and a peptide segment sequence is NH2-KLLSLIKGVIVHRLEGVE-GPSL-KDMQLGR-CONH2. A Th cell epitope sequence (KLLSLIKGVIVHRLEGVE) is from a measles virus fusion protein 288-302 peptide segment (MVF), and a four-residue linker (GPSL) is behind the T cell epitope. The linker is integrated into the fusion peptide to help independent folding of the T cell epitope and a B cell epitope. A B cell epitope sequence is a C segment fragment (KDMQLGR) of C5a. The polypeptide of the application can inhibit breast cancer tumor growth, enhance thymus T cell function output, and enhance T cell directional killing function on breast cancer, has low toxic side effects, and can be applied to breast cancer treatment, thereby providing a new scheme and a new idea for breast cancer treatment.