Target RAGE cytoplasm inner segment adaptor SLP76 and application of SAM
A TAT-SAM, cytoplasmic technology, applied in the field of biomedicine, can solve the problem of not significantly improving the survival time of patients with sepsis
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Example Embodiment
[0041] Example 1.
[0042] A SAM functional domain that targets the adaptor protein SLP76 of the intracytoplasmic segment of RAGE. After entering the cell, it binds to the intracytoplasmic segment of the cell membrane surface receptor RAGE, antagonizes the binding of SLP76 protein to the RAGE receptor, and inhibits RAGE-mediated downstream Signal transduction, reducing the release of cytokines.
[0043] Among them, the SAM functional domain of the SLP76 protein is brought into the cell through the cell penetrating peptide, and specifically can be brought into the cell through the TAT cell penetrating peptide.
[0044] The above-mentioned SAM functional domain of the adaptor protein SLP76 targeting the intracytoplasmic segment of RAGE has an amino acid sequence of YGRKKRRQRRRVLAWNSDNLADYF RKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKLRMPLLSKLSQDINKNEER.
[0045] The SAM functional domain of the adaptor protein SLP76 targeting the intracytoplasmic segment of RAGE has a clear application as a medi...
Example Embodiment
[0052] Example 2.
[0053] A targeted drug for the treatment of sepsis TAT and SAM functional domain fusion protein of SLP76 protein, with a fusion protein of TAT and SAM functional domain of SLP76 protein.
[0054] The targeted drug for the treatment of sepsis TAT and the SAM functional domain fusion protein of SLP76 protein is intravenous injection.
[0055] The targeted drugs targeting the SAM functional domain of SLP76 protein for the treatment of sepsis include small molecule compounds, dyes, polypeptides, polypeptide nucleic acids, proteins, plasmid DNA, siRNA, 200nm liposomes, phage particles, and ultra Paramagnetic particles, etc. mediate the way that the SAM functional domain of SLP76 protein enters the cell.
[0056] TAT is a cell penetrating peptide protein with a length of 11 amino acid residues, and the basic amino acid sequence is YGRKKRRQRRR. The advantages of the cell penetrating peptide protein as a carrier are low toxicity and no restriction of cell type. The f...
Example Embodiment
[0058] Example 3.
[0059] A screening method for identifying interacting proteins in the cytoplasm of the RAGE receptor: phage clones that can bind to the cytoplasm of RAGE are obtained from a cDNA library by phage display technology, and after 3 rounds of screening, a phage clone that can bind to the cytoplasm of RAGE is obtained. SLP76 protein bound to the inner segment. The cDNA library of the present invention is a human lung cDNA library. The screening times of the present invention are 2 to 5 times. The specific screening times in this embodiment are 3 times.
[0060] It should be noted that the screening times of the present invention may be 3 times, or 2, 4, or 5 times, and the specific implementation situation depends on the actual situation.
[0061] The present invention uses T7 phage display experiments to obtain phage clones that can bind to the intracytoplasmic segment of RAGE from the human lung cDNA library through 3 rounds of screening. After verification and DNA...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


