Unlock instant, AI-driven research and patent intelligence for your innovation.

Targeting of Rage intracytoplasmic segment linker SLp76 and use of SAM

A TAT-SAM, cell technology, applied in the field of biomedicine, can solve the problem of not significantly improving the survival time of patients with sepsis

Active Publication Date: 2021-11-02
SOUTHERN MEDICAL UNIVERSITY
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, neither the TLR4 receptor itself nor the TLR4 signal transduction pathway, nor the intervention of anti-cytokines (TNF-α, IL-1, etc.) can significantly improve sepsis in clinical treatment of sepsis patients. patient survival time
[0005] Although the current studies on multiple interventions in various aspects of TLRs have achieved satisfactory results in animal experiments, unfortunately none of the experimental results have passed phase III clinical research so far, so looking for new treatments for sepsis Strategies are particularly urgent and important

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Targeting of Rage intracytoplasmic segment linker SLp76 and use of SAM
  • Targeting of Rage intracytoplasmic segment linker SLp76 and use of SAM
  • Targeting of Rage intracytoplasmic segment linker SLp76 and use of SAM

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0042] A SAM functional domain targeting RAGE intracytoplasmic adapter protein SLP76, which binds to the intracytoplasmic segment of the cell membrane surface receptor RAGE after entering the cell, antagonizes the binding of SLP76 protein to RAGE receptors, and inhibits RAGE-mediated downstream Signal transduction, decreased cytokine release.

[0043] Wherein, the SAM functional domain of the SLP76 protein is brought into the cell through the cell-penetrating peptide, specifically, it can be brought into the cell through the TAT cell-penetrating peptide.

[0044] The SAM functional domain targeting RAGE cytoplasmic segment adapter protein SLP76 has an amino acid sequence of YGRKKRRQRRRVLAWNSDNLADYF RKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKLRMPLLSKLSQDINKNEER.

[0045] The SAM functional domain targeting RAGE intracytoplasmic segment adapter protein SLP76 has a clear application as a drug for treating RAGE-related inflammatory diseases. Specifically, as a drug for treating and inter...

Embodiment 2

[0053] The invention relates to a targeted drug for the fusion protein of SAM functional domain of TAT and SLP76 protein for treating sepsis, and has the fusion protein of SAM functional domain of TAT and SLP76 protein.

[0054] The targeted drug for the fusion protein of SAM functional domain of TAT and SLP76 protein used for treating sepsis is administered by intravenous injection.

[0055] The targeted drug targeting the SAM functional domain of SLP76 protein for the treatment of sepsis includes small molecule compounds, dyes, polypeptides, polypeptide nucleic acids, proteins, plasmid DNA, siRNA, 200nm liposomes, phage particles and super Paramagnetic particles, etc. mediate the way the SAM functional domain of SLP76 protein enters the cell.

[0056] TAT is a cell-penetrating peptide protein with a length of 11 amino acid residues and a basic amino acid sequence of YGRKKRRQRRR. The advantages of this cell-penetrating peptide protein as a carrier are low toxicity and no cel...

Embodiment 3

[0059] A screening method for identifying interacting proteins in the cytoplasmic segment of the RAGE receptor: phage clones capable of binding to the cytoplasmic segment of RAGE were obtained from a cDNA library by phage display technology, and phage clones capable of binding to the cytoplasmic segment of RAGE were obtained after three rounds of screening. Inner segment bound SLP76 protein. The cDNA library of the present invention is a human lung cDNA library. The number of times of screening in the present invention is 2 to 5 times. The specific number of screenings in this embodiment is 3 times.

[0060] It should be noted that the number of times of screening in the present invention may be 3 times, or 2, 4 or 5 times, and the specific implementation shall be determined according to the actual situation.

[0061] The present invention uses T7 phage display experiments to obtain phage clones capable of binding to the cytoplasmic segment of RAGE from the human lung cDNA l...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

A fusion protein of TAT and SAM functional domain of SLP76 protein has the effect of inhibiting inflammatory response during sepsis. The SAM functional domain of the SLP76 protein is brought into the cell through the cell-penetrating peptide TAT, competitively binds to the cytoplasmic segment of the RAGE receptor, and antagonizes the interaction between RAGE and the endogenous adapter protein SLP76 during the development of sepsis It can reduce the release of inflammatory factors in the process of sepsis by mediated cell signal transduction, so as to play a role in treating sepsis or improving prognosis. The SAM functional domain fusion protein of TAT and SLP76 protein can be used as a targeted drug for sepsis treatment. It is a polypeptide that directly passes through the cell membrane and enters the cell in a non-classical endocytic manner. Its important feature is that it can carry a variety of different sizes and properties. biologically active substances into cells.

Description

technical field [0001] The invention belongs to the field of biomedicine, and particularly relates to the use of a SAM functional domain targeting RAGE intracytoplasmic segment adapter protein SLP76 (SH2 domain containing leukocyte protein of 76kDa) as a drug for treating RAGE-related inflammatory diseases. Background technique [0002] Sepsis is a systemic inflammatory response syndrome (SIRS) caused by pathogenic microorganism infection. It is a common complication in critically ill patients after severe trauma, burns, and major surgery. septic shock), acute respiratory distress syndrome (acuterespiratory distress syndrome, ARDS) and multiple organ dysfunction syndrome (multiple organdysfunction syndrome, MODS). The incidence of sepsis is high. There are more than 18 million cases of severe sepsis every year in the world, and this number is still increasing at a rate of 1.5% to 8.0% per year. Epidemiological surveys show that the fatality rate of sepsis has surpassed that...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/00C07K19/00A61K38/16A61K47/42A61P29/00A61P35/00A61P9/00A61P9/10A61P25/28A61P31/04
CPCA61K38/00A61K47/42A61P9/00A61P9/10A61P25/28A61P29/00A61P31/04A61P35/00C07K14/00C07K2319/10
Inventor 姜勇闫征征罗海华
Owner SOUTHERN MEDICAL UNIVERSITY