Targeting of Rage intracytoplasmic segment linker SLp76 and use of SAM
A TAT-SAM, cell technology, applied in the field of biomedicine, can solve the problem of not significantly improving the survival time of patients with sepsis
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0042] A SAM functional domain targeting RAGE intracytoplasmic adapter protein SLP76, which binds to the intracytoplasmic segment of the cell membrane surface receptor RAGE after entering the cell, antagonizes the binding of SLP76 protein to RAGE receptors, and inhibits RAGE-mediated downstream Signal transduction, decreased cytokine release.
[0043] Wherein, the SAM functional domain of the SLP76 protein is brought into the cell through the cell-penetrating peptide, specifically, it can be brought into the cell through the TAT cell-penetrating peptide.
[0044] The SAM functional domain targeting RAGE cytoplasmic segment adapter protein SLP76 has an amino acid sequence of YGRKKRRQRRRVLAWNSDNLADYF RKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKLRMPLLSKLSQDINKNEER.
[0045] The SAM functional domain targeting RAGE intracytoplasmic segment adapter protein SLP76 has a clear application as a drug for treating RAGE-related inflammatory diseases. Specifically, as a drug for treating and inter...
Embodiment 2
[0053] The invention relates to a targeted drug for the fusion protein of SAM functional domain of TAT and SLP76 protein for treating sepsis, and has the fusion protein of SAM functional domain of TAT and SLP76 protein.
[0054] The targeted drug for the fusion protein of SAM functional domain of TAT and SLP76 protein used for treating sepsis is administered by intravenous injection.
[0055] The targeted drug targeting the SAM functional domain of SLP76 protein for the treatment of sepsis includes small molecule compounds, dyes, polypeptides, polypeptide nucleic acids, proteins, plasmid DNA, siRNA, 200nm liposomes, phage particles and super Paramagnetic particles, etc. mediate the way the SAM functional domain of SLP76 protein enters the cell.
[0056] TAT is a cell-penetrating peptide protein with a length of 11 amino acid residues and a basic amino acid sequence of YGRKKRRQRRR. The advantages of this cell-penetrating peptide protein as a carrier are low toxicity and no cel...
Embodiment 3
[0059] A screening method for identifying interacting proteins in the cytoplasmic segment of the RAGE receptor: phage clones capable of binding to the cytoplasmic segment of RAGE were obtained from a cDNA library by phage display technology, and phage clones capable of binding to the cytoplasmic segment of RAGE were obtained after three rounds of screening. Inner segment bound SLP76 protein. The cDNA library of the present invention is a human lung cDNA library. The number of times of screening in the present invention is 2 to 5 times. The specific number of screenings in this embodiment is 3 times.
[0060] It should be noted that the number of times of screening in the present invention may be 3 times, or 2, 4 or 5 times, and the specific implementation shall be determined according to the actual situation.
[0061] The present invention uses T7 phage display experiments to obtain phage clones capable of binding to the cytoplasmic segment of RAGE from the human lung cDNA l...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


