27 results about "Critically ill" patented technology

This invention discloses an infection early warning model and prediction system for critically ill patients based on multimodal monitoring data, belonging to the field of medical artificial intelligence and clinical decision support technology. The system collects multi-source heterogeneous physiological signals, laboratory test indicators, imaging features, and nursing records from patients. Through a self-designed cross-modal feature fusion algorithm and dynamic weight adjustment mechanism, it constructs a nonlinear infection risk prediction model. Furthermore, time-series segmented coding and adaptive threshold correction methods are introduced during model training to achieve early and accurate infection early warning. Compared with existing technologies, this invention significantly improves the sensitivity and specificity of prediction and maintains stable performance across different departments and diseases.

This application provides a multi-agent, multimodal collaborative method, device, equipment, and storage medium for diagnosing the condition of patients in the intensive care unit (ICU), belonging to the field of medical artificial intelligence and intelligent analysis technology for intensive care. The method includes: receiving multimodal clinical monitoring data in an ICU setting, including bedside medical images, continuous life time series, and critical care clinical text; identifying and adaptively routing the input data through a modality detection agent, distributing it to corresponding domain expert agents for pathological and physiological feature extraction; constructing a patient-centric graph structure representing the dynamic clinical condition of ICU patients through a knowledge graph agent based on the features output by each domain expert agent, this graph structure integrating structured medical knowledge of entity extraction and relational reasoning; further, inputting the constructed graph structure and original multimodal features into a collaborative agent, generating the final ICU patient condition diagnosis result (such as mortality prediction, ICU long-stay prediction, etc.) and a traceable reasoning path through graph traversal and collaborative reasoning. This application effectively breaks down data silos between different monitoring devices in the intensive care unit environment, dynamically captures cross-modal associations specific to critically ill patients, and significantly improves the accuracy of critical care clinical diagnosis and medical trust.

This invention relates to the field of clinical medical and nursing device technology, specifically to an auxiliary turntable for blood glucose management and insulin dose adjustment in critically ill patients. It includes a base and a recommendation component. A support column is fixedly connected to the top of the base. The recommendation component includes a recommendation disc fitted outside the support column. A judgment component, including a judgment disc fitted outside the support column, is fitted outside the support column and is located on top of the recommendation cover. An identification component, including an identification disc fitted outside the support column, is fitted outside the support column. A base component, including a base disc fitted outside the support column, is located on top of the identification cover. Through the base, support column, and four sets of adjustment components, standardized and visual matching of multiple blood glucose indicators and insulin adjustment recommendations is achieved. Combined with three-color risk label strips, it quickly identifies abnormal blood glucose levels and fluctuation risks, enabling early detection and intervention, and reducing dose adjustment errors due to experience.

This utility model relates to the field of rehabilitation training restraint devices, specifically disclosing a protective blanket for wheelchair functional training. The blanket includes a blanket body, with an upper limb fixing liner on one side, a chest fixing elastic band below the upper limb fixing liner, and two lower limb fixing liner symmetrically positioned below the chest fixing elastic band. The blanket body has two symmetrical strip-shaped openings running through both sides, with several Velcro straps along the sides of the strip-shaped openings. The edge of the blanket body is fitted with a connecting mechanism for connection with a wheelchair. This utility model enables convenient fixation to a wheelchair and allows for flexible coordination with the wheelchair, facilitating early wheelchair functional training for critically ill patients and preventing falls, tube removal, and other accidents during early activity.

This invention relates to the field of medical and nursing technology, specifically to a patient care support device for critical care, comprising a base plate and two support components disposed opposite each other on the top left and right sides of the base plate. It also includes a dual-mode control mechanism disposed between the two support components and connected to the middle of a three-way gas channel on the inner front side of the base plate via a support tube. Both ends of the three-way gas channel are connected to the two support components respectively. Two openable seat panels are disposed opposite each other and are movably connected to the two support components via sliding frames and closed and fixed by locking plates. This invention addresses the significant shortcomings of existing critical care support devices in meeting the core needs of transferring and connecting critically ill patients with limited leg mobility, including height adjustment, safe fixation, and flexible transport. These devices struggle to balance ease of operation, transport safety, and scenario adaptability, and cannot effectively solve the problem of efficient and safe transport of such patients in clinical and home care.

This invention provides a bedside hemofiltration method and system for elderly critically ill patients, comprising: analyzing the correlation between transmembrane pressure changes and venous pressure fluctuations under the control of vascular access type and puncture angle, based on a dynamic trend description, and simultaneously evaluating the corrective effect of signal compensation mechanisms on data accuracy to obtain a set of parameter correlation strengths; if some values ​​in the parameter correlation strength set exceed a preset threshold, then combining monitoring data on access infection risk and fluctuations in signal transmission distance, determining whether there is a chain reaction caused by access abnormality, and obtaining an abnormal chain reaction identifier; for the abnormal chain reaction identifier, determining the degree of danger of the abnormality to the overall system by analyzing the matching degree between access establishment time and attenuation frequency range, and obtaining a danger level classification result.

A dynamic multi-model counterfactual intervention prediction method for critically ill patients includes: acquiring patients' clinical medical data and preprocessing the clinical medical data; extracting features from the preprocessed clinical medical data to obtain key physiological features; processing the key physiological features using a fitted SOFA scoring algorithm to obtain the patient's organ dysfunction score; assessing the patient's risk level based on the organ dysfunction score; conducting factual intervention tests on the patient to evaluate the confidence of each LLM; performing LLM collaborative counterfactual prediction based on the patient's risk level assessment and factual intervention test to obtain counterfactual prediction results; inputting the counterfactual prediction results and clinical medical data into an LLM pool for evaluation to obtain a credibility score; constructing weights based on the credibility score; synthesizing credibility based on the weights; and generating an interpretability report. This invention effectively avoids the "illusion" and bias of single models through multi-LLM collaboration and cross-validation, and selects more credible intervention plans.

This utility model discloses a suspended turning assist belt structure for bedside use, including an upper body turning pad structure, a lower body turning pad structure, a turning drive structure, and a controller. The controller is communicatively connected to the turning drive structure. This utility model effectively combines the upper body turning pad structure, the lower body turning pad structure, and the turning drive structure, enabling a single medical staff member to perform turning operations on a patient independently, without the need for multiple medical staff to cooperate. This is especially convenient for critically ill patients with various tubes, comatose patients who cannot cooperate, and obese patients.

The invention discloses a limb fixing device for a critical patient, belongs to the technical field of limb fixing, and aims to solve the problems that the contact area between a bandage and the arm of the patient is small, the constraining force is concentrated, pressure injury is easily formed due to long-time constraining, the pain of the patient is increased, local infection is possibly caused, and the illness state is aggravated. The hospital bed comprises a hospital bed body and two supporting plates fixed to one side of the hospital bed body, restraint straps are arranged on one sides of the supporting plates, a plurality of first pressure air bags are installed on one sides of the restraint straps, a plurality of second pressure air bags are further installed on one sides of the restraint straps, and the second pressure air bags and the first pressure air bags are arranged in a staggered mode. Alternate inflation and deflation of the first pressure air bag and the second pressure air bag are achieved through the two-way air pump, so that the pressed parts of the limbs are continuously alternated, local skin and soft tissue are prevented from being in a pressed state for a long time, local blood circulation is effectively improved, the problems of skin redness, pressure sores, limb ischemia and the like are solved, and the completeness of the limb tissue of a patient is protected.

This invention discloses a nursing resource allocation and management method and system based on emergency triage information. It introduces a dynamic split weight mechanism, first calculating the global correlation density of each triage feature to quantify its statistical value in the overall population, and simultaneously calculating local mutation significance factors to capture its weak but crucial discriminative information in critically ill samples. Then, the two are combined to generate dynamic split weights, which are used to optimize the split gain of features in the prediction model. This allows the gradient boosting decision tree algorithm to overcome the limitations of traditional global gain bias towards strong features during feature selection, effectively identifying those latent critically ill key features with low global importance but significant local mutations, significantly improving the prediction accuracy for latently critically ill patients. Based on accurate risk prediction results, nursing resources are dynamically allocated, realizing a shift from passive response to proactive intervention, and solving the technical problem of existing technologies failing to intervene in a timely manner due to missed identification of high-risk patients.

This invention relates to the field of medical monitoring technology, specifically to an intelligent multi-parameter risk early warning system for critically ill patients. The system transforms ventricular amplitude and pulse pressure sequences within a preset sliding data window to determine relative amplitude and relative pulse pressure sequences; it then determines pulse pressure variability based on the pulse pressure difference sequence within the window; it determines a reference conduction time based on the electromechanical delay sequence within the window; it constructs a matching cost matrix based on the reference conduction time, relative amplitude, and relative pulse pressure sequences, and solves for the optimal matching relationship; it constructs an excitation-response data pair set based on the optimal matching relationship and determines a waveform difference index; it determines the response inversion ratio based on the set; and it performs graded screening based on pulse pressure variability, waveform difference index, and response inversion ratio to determine physiological status and output corresponding risk warnings, thereby significantly improving the ability to identify early cardiovascular abnormalities.

This invention relates to a plasma therapy device with a treatment chamber, comprising a treatment bed and a treatment chamber mounted on the treatment bed. The treatment chamber is reciprocating along the length of the treatment bed. A plasma therapy head is disposed within the treatment chamber, and the plasma therapy head is reciprocating along the Y-axis and Z-axis within the treatment chamber, and can rotate around the X-axis and Z-axis within the treatment chamber. The plasma therapy head of this invention can provide irradiation therapy to different parts of the patient from head to toe in different directions, without requiring the patient to move; only the treatment head moves. It provides a wide irradiation range and large area, making it particularly suitable for the treatment of critically ill patients. It is stable, reliable, and simple and convenient to operate.

This invention relates to a multifunctional rehabilitation exercise device, and more particularly to a multifunctional rehabilitation exercise device for neurosurgical critical care, comprising a base, a base column, a sleeve, a support plate, a support frame, a backrest, a seat, armrests, an N-shaped bar, a handle, a counterweight, and support rods. The base column is mounted on the base, and a sleeve is rotatably connected within the base column. A connecting column is fitted inside the sleeve, and a seat is connected to the connecting column. A backrest is provided on the rear side of the seat, and armrests are symmetrically mounted on the seat. A support frame is rotatably connected to the upper part of the backrest, and a support plate connects the support frame and the sleeve. A connecting plate is mounted on the lower side of the base, and adjustable-length support rods and wheels are mounted on the connecting plate. The N-shaped bar is slidably connected to the base. This invention, by setting counterweights, meets the needs of patients at different stages. For some critically ill patients, a dual-axis motor drive replaces hand movements, allowing the patient's hands and feet to be exercised.

Anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for the treatment of a critically ill patients suffering from an acute disease or condition resulting in the accelerated the conversion of ADM-Gly to ADM-NH2 of circulating ADM-Gly in the patient. The patient has a ratio of pro-Adrenomedullin or a fragment thereof to ADM-NH2 above a predetermined threshold in a sample of bodily fluid. The pro-Adrenomedullin or fragment thereof is PAMP, MR-proADM, ADM-Gly or CT-proADM and the anti-ADM antibody or anti-ADM fragment or anti-ADM non-Ig scaffold binds to the N-terminal and / or mid-regional part (amino acid 1-42) of ADM-Gly and / or ADM-NH2: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVA.

This invention discloses a dynamic hemodynamic monitoring and support system for critically ill ICU patients, relating to the field of medical monitoring technology. Through a multi-parameter synchronous acquisition module, it achieves simultaneous and linked acquisition of hemodynamic parameters and coagulation function indicators. A data preprocessing module performs precise filtering, outlier removal, and missing value completion on the acquired raw data. A dynamic coupling analysis module constructs a quantitative blood flow-coagulation correlation model, which can dynamically adjust parameter warning thresholds based on the patient's individual characteristics and condition, accurately calculate coupling risk values, and determine risk types and levels. An intelligent intervention and control module formulates differentiated treatment plans based on coupling risks and achieves closed-loop intervention through a feedback correction mechanism. A display, alarm, and data storage module realizes the visualization of multi-dimensional information and full-process data retention, achieving dynamic coupling monitoring and intelligent support for hemodynamics and coagulation function.

This utility model discloses an intelligent air mattress for turning over and preventing pressure sores in critically ill cardiovascular patients, belonging to the field of medical device technology. The utility model includes a base plate with a baffle fixedly connected to the top outer wall of the base plate. By setting up a control panel and automatic telescopic rods, the extension distance of multiple automatic telescopic rods at the bottom can be changed by operating the control panel, thereby causing the automatic telescopic rods to push one side of the air mattress upwards. The other side of the air mattress is confined to the base plate, so the movement of the automatic telescopic rods causes the air mattress to bend, with the bending part precisely near the waist. This allows the patient to adjust the shape of the bed to conform to the human body curve by controlling the control panel. The height of the automatic telescopic rods can be adjusted by the control panel, causing the telescopic rods to push one side of the air mattress upwards and bend it, preventing pressure sores. For critically ill cardiovascular patients, prolonged lying flat can easily lead to the accumulation of respiratory secretions in the lungs, making it difficult to expel and causing breathing difficulties.

This utility model provides a transport vehicle for critically ill newborns in the field of medical technology. It mainly includes a frame, which is divided into an upper and lower layer. Both front wheels on the upper and lower layers are triangular wheels used for climbing stairs, and both rear wheels are swivel wheels. A limiting bracket for securing oxygen cylinders is installed on the lower frame. A fixing plate with multiple fixing holes is installed on the upper surface of the lower layer. An electrocardiogram monitor and a transport ventilator can be detachably installed through these holes. A crib is installed on the upper layer. The mattress on the crib has fixing straps on both sides, and connecting holes on both sides. The fixing straps on both sides of the mattress extend outwards from the connecting holes and are fixed. Both sides of the mattress are covered with swaddle blankets, each with straps, which are used to secure the swaddle blankets to the mattress. This utility model facilitates transporting newborns by allowing them to be secured during descent down stairs.

This invention belongs to the field of temperature sensing technology and discloses a thermosensitive hydrogel for body temperature monitoring, its preparation method, and its applications. The preparation method includes: preparing a thermosensitive regulating monomer solution containing a thermochromic agent with a color-changing range of 38℃-40℃; preparing a crosslinking solution; mixing the thermosensitive regulating monomer solution and the crosslinking solution to obtain a mixture; adding an initiating solution to the mixture, stirring evenly, and pouring it into a mold for standing to obtain the thermosensitive hydrogel. The thermosensitive hydrogel prepared by this invention has characteristics such as temperature response in the body temperature range, colorimetric monitoring, persistent adhesion, and cycle stability. It is suitable for monitoring the body temperature of infants, critically ill patients, etc., in the form of health indicator bracelets or patches. It is also applicable to applications in temperature-sensitive jewelry, anti-counterfeiting encryption, and temperature-sensing early warning systems for electronic devices.

This invention discloses a fixation device for ECMO transport, relating to the field of medical device technology. It includes a support plate with a fixation box fixed to the top of the support plate, a clamping plate on the top of the fixation box, the top of the clamping plate being L-shaped, extension rods fixed to both sides of the clamping plate, a force-bearing plate on the top of the fixation box, a rotating sleeve rotatably connected inside the fixation box, and a fixing post fixed to the bottom of the force-bearing plate, with its bottom end inserted into the rotating sleeve. The fixing post has a spiral groove. The advantages of this invention are: the clamping plate can quickly and automatically clamp the ECMO using gravity, eliminating the need for repeated wrapping and tightening by medical personnel, significantly simplifying the fixation and disassembly process, shortening operation time, effectively improving the speed of medical emergency response, meeting the core need of "every second counts" in the transport of critically ill patients, and avoiding delays in treatment due to cumbersome operations in emergency scenarios.

This invention relates to the field of medical device technology and discloses an easily adjustable intelligent drainage device for critically ill neurosurgical patients. The device includes a drainage tube, a collection bag, a control box, a flow rate regulator, and a magnetically self-locking reflux device. The drainage tube includes an inlet end near the patient's cranium and an outlet end connected to the collection bag. The flow rate regulator and the magnetically self-locking reflux device are positioned between the inlet and outlet ends. The control box contains a main control module, a display module, and a storage module. The collection bag is specifically a sterile inner bag with a miniature patch-type liquid level sensor. The sterile inner bag is connected to the outlet end. An infrared drip rate sensor is installed on the outer wall of the inlet end. Both the liquid level sensor and the infrared drip rate sensor are electrically connected to the main control module. This invention achieves intelligent and precise drainage of cerebrospinal fluid, prevents reflux and blockage, provides automatic monitoring and early warning, reduces complications, alleviates the burden on medical staff, and improves drainage safety and efficiency.

This utility model discloses a turning assistance device for critically ill patients, including a fixed base. Storage drawers are inserted into the left and right front ends of the fixed base. A first support seat is fixedly installed on the upper left and upper right ends of the fixed base. A bed board is fixedly installed on the upper end of the fixed base. A turning device is movably installed on the left and right ends of the bed board. A lifting device is fixedly installed at the rear end of the bed board. This utility model allows the first mounting frame to be lifted upwards using a first handle. At this time, the first mounting frame flips up within a movable groove on the bed board, thereby turning the patient on the first mounting frame to the other side of the bed board. Similarly, when the patient is on a second mounting frame, lifting the second mounting frame upwards can also turn the patient to the other side of the bed board. Additionally, the second handle can lift the lifting board within the fixed frame, thereby lifting the patient's upper body.

This invention relates to the field of medical emergency and telemedicine technology, and in particular to an online diagnosis and treatment system. Addressing the problems of lagging information transmission and lack of intelligent data analysis in existing traditional pre-hospital emergency care models, this invention proposes the following solution: a portable emergency intelligent terminal, a cloud-based big data and artificial intelligence analysis platform, a hospital-side command and preparation system, and a high-speed mobile communication network. The portable emergency intelligent terminal is deployed at the emergency site to collect and preprocess patient physiological and environmental data and transmit it in real time. After receiving the data, the cloud platform retrieves the patient's historical health data, diagnoses and evaluates the patient using an AI model, and generates a personalized dynamic emergency care plan based on a knowledge graph. This invention achieves real-time, multi-dimensional collection and intelligent analysis of pre-hospital emergency care data, breaks down information barriers between pre-hospital and in-hospital care, provides dynamic optimization solutions for on-site emergency care, guides precise in-hospital preparation, significantly improves emergency care efficiency and accuracy, and reduces the prognostic risks for critically ill patients.

This invention discloses a pressure ulcer prevention treatment bed for critically ill patients, relating to the field of medical device technology. The pressure ulcer prevention treatment bed includes a bed frame, an inflatable mattress, several pressure sensors, a support assembly, and a control assembly. The inflatable mattress has at least one support hole penetrating through it. Several pressure sensors are installed at preset positions on the inflatable mattress. The support assembly includes a support pad located within the support hole. The control assembly includes a controller and a drive unit. The support pad can slide freely within the support hole. The drive unit controls the raising and lowering of the support pad to adjust the height difference between the upper surface of the support pad and the upper surface of the inflatable mattress. The drive unit and several pressure sensors are electrically connected to the controller, forming an active and continuous pressure point transfer, effectively preventing prolonged pressure on local tissues, preventing pressure ulcers at their source, and effectively drying damp areas, reducing discomfort or skin problems caused by moisture.

This invention provides a clinical decision support method and system for coagulation management in critically ill patients. The method includes acquiring multimodal physiological parameters of critically ill patients and nonlinearly fusing them to generate coagulation status feature vectors; constructing a cue binary tree model with bidirectional risk vectors embedded in each node, and left and right cues representing source tracing and default prognosis pointers, respectively; mapping the feature vectors to the model to locate the current node; backtracking previous nodes to extract trajectory weight vectors; weighting the baseline intervention efficacy matrix based on the vectors to generate a patient-specific matrix; solving an optimization problem based on this matrix and the bidirectional risk vector of the current node to obtain the optimal intervention vector; calculating the post-intervention risk vector; generating conditional prognosis pointers; and generating a clinical decision plan containing specific intervention types and intensities based on the optimal intervention vector, thereby assisting in the coagulation management of critically ill patients.

This invention relates to the field of intensive care technology, specifically to an integrated system for real-time hemodynamic monitoring and early warning of critically ill ICU patients. The system includes: a physiological signal synchronous acquisition and quality enhancement module for acquiring and processing multi-channel physiological waveforms; a core physiological state vector calculation module, based on a first-principles model of the circulatory system, for real-time calculation of the left ventricular maximum contractile elasticity Emax, representing myocardial contractility, and the gain coefficient γk, representing preload responsiveness; a dynamic risk assessment and early warning module, which predicts decompensation risk and triggers early warnings by fusing temporal features through a bidirectional gated circulatory unit neural network; a personalized physiological simulator module, which dynamically calibrates a cardiovascular mechanism model using an unscented Kalman filter to generate a physiological image of the patient; and a system adaptive evolution module, which iteratively optimizes model parameters through a two-layer closed-loop mechanism. This invention achieves closed-loop management from accurate perception and risk prediction to personalized decision support.

This application relates to a method, system, device, and medium for intelligent assessment and management of extubation risk in critically ill patients. The method includes: acquiring high-frequency waveform data and low-frequency discrete clinical indicator data of the patient, constructing a hierarchical multi-scale time window; extracting features from the high-frequency waveform data and low-frequency discrete clinical indicator data respectively, obtaining a high-frequency feature sequence for the short-term state window and a multi-dimensional low-frequency feature representation for the long-term trend window, and performing cross-modal semantic alignment to generate an aligned feature sequence; performing multi-layer fusion on the aligned feature sequence to obtain the final feature representation, and inputting it into a multi-task output layer to output the probability value of successful extubation and the uncertainty variance of the probability value; combining this with a preset decision threshold to generate a risk assessment level. This method can effectively solve the time scale differences and semantic gap between high-frequency waveforms and low-frequency indicators, significantly improving the accuracy and reliability of extubation risk prediction.

A combination of sodium thiosulfate, zinc and magnesium and, optionally, Vitamin C is used to treat dengue fever. The components may be used or ingested or administered either simultaneously or sequentially in about 30 minutes separate administration. These Supplements are used to replace the zinc and magnesium which may be depleted from the body during treatment. Also, Vitamin C is used as an anti-viral composition. In cases where the patient is critically ill, a quantity of acetylsalicylic acid is administered.