Unlock instant, AI-driven research and patent intelligence for your innovation.

c20orf24 protein deletion mutant and its application

A technology for deletion of mutants and proteins, applied in the field of medicine, can solve the problem of limited related drugs, achieve broad use value and inhibit the proliferation and growth of cancer cells.

Active Publication Date: 2021-12-03
JINAN UNIVERSITY
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

At present, the relevant drugs targeting this Ras are still very limited

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • c20orf24 protein deletion mutant and its application
  • c20orf24 protein deletion mutant and its application
  • c20orf24 protein deletion mutant and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0026] 1. Construction of recombinant plasmid pLVX-Puro-mCherry-HA-C20orf24: The recombinant plasmid of pLVX-Puro-mCherry-HA-C20orf24 was constructed on the backbone of pLVX-IRES-ZsGreen1 vector (Clontech, Cat#632187), using homology Recombination method, using C112-ClonExpress II One Step Cloning Kit (Novizan, Cat#C112-01), C20orf24, mCherry-HA two gene fragments were inserted into pLVX-IRES-ZsGreen1 vector according to the sequence of mCherry-HA-C20orf24 , as follows:

[0027] (1) Total RNA was extracted from human colorectal cancer HCT116 cells (purchased from the Cell Resource Center, Shanghai Academy of Biological Sciences, Chinese Academy of Sciences), and the reverse transcription product was used as a cDNA template; C20orf24 was obtained through PCR amplification experiments, gel recovery and purification (GenBank access No. NM_018840.5) gene fragment; PCR primers are C20orf24 UP and C20orf24 DW.

[0028] C20orf24 UP: 5'-ATGTACCCATACGATGTTCCAGATTACGCTAGCGGCGGGCGGCGG-3...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a C20orf24 protein deletion mutant and application thereof. A C20orf24 protein deletion mutant is a C20orf24 protein lacking a Rab5ip domain; its amino acid sequence is MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAW EDKDEFLDGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIHYD. The C20orf24 protein deletion mutant has the effect of inhibiting the proliferation and growth of cancer cells, and its application in the preparation of cancer treatment drugs shows its broad application value.

Description

technical field [0001] The invention belongs to the technical field of medicine, and in particular relates to a C20orf24 protein deletion mutant and its application. Background technique [0002] Colorectal cancer is one of the most difficult diseases to treat in the world, characterized by high morbidity, high mortality and poor survival prognosis. The current mainstream treatment method is a combination of surgery and radiotherapy and chemotherapy. In the field of targeted therapy, the angiogenesis factor (VEGF) inhibitor bevacizumab and the epidermal growth factor receptor blocker panitumumab are widely used. , cetuximab, and erlotinib. Nevertheless, the clinical efficacy is still unsatisfactory, and the occurrence of chemotherapy resistance and toxic side effects affects the prognosis of cancer patients. It is imperative to further develop targeted drugs against oncogenes. [0003] In colorectal cancer, the Ras / MAPK signaling pathway is one of the most actively studied...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/47C12N15/12A61K38/17A61P35/00A61P35/02
CPCA61K38/00A61P35/00A61P35/02C07K14/47
Inventor 张静汪洋何庆瑜
Owner JINAN UNIVERSITY
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More