Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A kind of polypeptide eip-22 that can antagonize the rna binding activity of ewsr1 protein and its application

A technology that combines activity and protein, applied in the direction of hybrid peptides, peptide/protein components, medical preparations containing active ingredients, etc., to achieve the effect of inhibiting tumors and improving efficiency

Active Publication Date: 2020-03-27
XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Currently, EWSR1-specific inhibitors have not been reported

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of polypeptide eip-22 that can antagonize the rna binding activity of ewsr1 protein and its application
  • A kind of polypeptide eip-22 that can antagonize the rna binding activity of ewsr1 protein and its application
  • A kind of polypeptide eip-22 that can antagonize the rna binding activity of ewsr1 protein and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0024] The principles and features of the present invention are described below in conjunction with examples, which are only used to explain the present invention and are not intended to limit the scope of the present invention.

[0025] 1. Synthesis of Antitumor Peptides

[0026] Synthesize an anti-tumor polypeptide by solid-phase synthesis, which includes a tumor cell killing domain and a membrane-penetrating domain, wherein the tumor cell killing domain sequence is shown in SEQ ID NO: 1, and the membrane-penetrating domain sequence is as shown in SEQ ID NO: 1 As shown in ID NO: 2, it is connected to the N-terminal of the tumor cell killing domain, and the obtained sequence is: the amino acid sequence is YGRKKRRQRRR-RTGQPMIHIYLDKETGKPKGDK (SEQ ID NO: 3), named EIP-22. For the convenience of research, we linked FITC labeled with fluorescein isothiocyanate to the C-terminus of the anti-tumor polypeptide, and linked biotin-labeled Biotin to the N-terminus.

[0027] The tumor s...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention provides a polypeptide that can antagonize the RNA binding activity of EWSR1 protein and its application, and its amino acid sequence is shown in SEQ ID NO: 1; it also relates to an anti-tumor polypeptide and its application, and the anti-tumor polypeptide includes tumor cells The killing domain and the membrane-penetrating domain, the amino acid sequence of the tumor cell killing domain is shown in SEQ ID NO:1. The transmembrane domain of the anti-tumor polypeptide of the present invention has no cytotoxicity itself, but after linking with the tumor cell killing domain, it has obvious effects of inhibiting tumor proliferation, migration and invasion. The anti-tumor polypeptide of the present invention can not only be used as an anti-tumor biotherapeutic drug alone, but is also expected to be combined with other treatment methods to inhibit tumors.

Description

technical field [0001] The invention relates to the field of tumor targeting therapy, and more particularly relates to a polypeptide capable of antagonizing the RNA binding activity of EWSR1 protein and its application. Background technique [0002] Cancer is a major public health problem in the world and has been widely concerned by people. According to the reports of the International Union Against Cancer (UICC) and the World Health Organization (WHO), the global cancer incidence and mortality have continued to rise in recent years. With the continuous growth of the population and the appearance of aging, there are increasing cases of death from malignant tumors every year. [0003] The incidence of cancer worldwide is gradually increasing. According to statistics, 1 out of every 8 deaths is cancer. The grim reality forces humans to constantly seek new ways to treat cancer. Due to the significant individual differences in tumors, traditional medical methods have great lim...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/00C07K19/00A61K38/16A61K47/42A61P35/00
Inventor 童强松郑丽端李欢欢杨枫陈亚俊叶霖李聃宋华杰
Owner XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More