A method for positioning and expressing foreign protein in mitochondria
A technology of exogenous protein and mitochondria, applied in the field of molecular genetics, can solve difficult problems such as the location of signal expression
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0068] This embodiment provides a signal peptide and its coding sequence, the sequence of which is as follows:
[0069] 1. PSBR1 DNA sequence:
[0070] ATGGAGGAAGATGGTAGTGGTACGCTTCTACGGCGTATGCTGCATAAGGCA GTATGGGCAGCGAGAGCCATAGCTCACCTCCGTCCATCTCCGACGACGAC GACGACACCGGCAACGACGCCCAGCCGGCTCCCACCGAGCCTGCTGGAC TGCACCGACGACGACGACGCCGCGTCGACTGCCGGGTGTCCGAGCTTCCA CACGGCGAGCAGCACCCCGGACTGGGCCGTCCACTCGTGGCTGCCCAGCC CCGGCGCCGTCGAGGTCGACGGCGACAGGCGCGCCGAGGAGTTCATCGA GAGGTTCTGGCGCAACGTGTCCCTGGAGCTGCGGTACTGCTCGCCGGTTA CGCCCGCCAGGCCGCCCGTGTCGCCGGACACGTACTTCAACCTCTCGAGG CTTAGTCATAGGATCTGCCTTGATTGA
[0071] 2. PSBR1 amino acid sequence
[0072] MEEDGSGTLLRRMLHKAVWAARAIAHLRPSPTTTTTPATTPSRLPPSLLDCTDDDDAASTAGCPSFHTASSTPDWAVHSWLPSPGAVEVDGDRRAEEFIERFWRN VSLELRYCSPVTPARPPVSPDTYFNLSRLSHRICLD
Embodiment 2
[0074] This embodiment provides a method for localized expression of foreign proteins in mitochondria: comprising the following steps:
[0075] 1. Construction of the vector PSBR1-YFP with YFP yellow fluorescence linked to the C-terminus of the signal peptide
[0076] Clone PSBR1: Search the PH01000831G0490 sequence in the BambooGDB database (http: / / www.bamboogdb.org / ), and name it PSBR1. The primers PSBR1-F: 5'-ATGGAGGAAGATGGTAGTGG-3' and PSBR1-R: 5'-ATCAAGGCAGATCCTATGAC-3' were designed according to the open reading frame (ORF) of PSBR1 sequence in Moso bamboo. Total RNA from Moso bamboo leaves was prepared using a total RNA extraction kit (Tiangen Biotech Co., Ltd., Beijing, China) according to the manufacturer's protocol.
[0077] First-strand cDNA was synthesized from 1 μg of total RNA using the GoScript™ Reverse Transcription System (Promega Biotech, Co., Ltd., Beijing, China). Using cDNA as a template for PCR, amplification was performed with primers PSBR1-F and PSBR1...
Embodiment 3
[0116] Application of DNA sequence and amino acid sequence of signal peptide PSBR1 to localize and express foreign protein in mitochondria.
[0117] Beneficial effects: The subcellular localization information of proteins predicted by amino acid sequences is not yet very accurate, and large-scale proteomics methods are difficult to separate low-abundance proteins, and contamination cannot be avoided in the preparation of protein samples. Certain limitations. It is difficult to judge the specific organelle for the point-like structure in the cell, and because the mitochondria are very high in the cells of some tissues and are distributed anywhere in the cell, this is often misjudged as expressed in any area of the cell. Therefore, it is very important to have a mitochondrial localized marker gene as a control. In this study, a sequence of a Phyllostachys pubescens gene was cloned, constructed into an expression vector, and transformed into Agrobacterium to express transientl...
PUM
| Property | Measurement | Unit |
|---|---|---|
| capacitance | aaaaa | aaaaa |
| electrical resistance | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 



