Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Therapeutic peptides

a technology of peptides and peptides, applied in the field of therapeutic peptides, can solve problems such as weight loss of 0.6 kg

Inactive Publication Date: 2016-04-21
GLAXOSMITHKLINE INTPROP DEV LTD
View PDF2 Cites 16 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Prevention and treatment of obesity are areas of high unmet medical need, with few medications currently available for chronic weight loss therapy.
Administration of a PYY(3-36) nasal spray reduced daily caloric intake of obese individuals by 2713 kJ, resulting in a weight loss of 0.6 kg over a six-day study period.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Therapeutic peptides
  • Therapeutic peptides
  • Therapeutic peptides

Examples

Experimental program
Comparison scheme
Effect test

example 1

[0067]

(SEQ ID NO: 3)PKPEAPGKDASPEELNRYYASLRHYLNWVTRQRY-NH2

[0068]Example 1 was prepared on a 35 μmol scale as a white solid using the general method. The molecular mass of the isolated peptide was confirmed by fragment ions (M+3) / 3−1369 amu and (M+4) / 4−1027 amu, which corresponds to a peptide with the parent molecular weight of 4105 amu (ESI-MS, LC / MS Method A). A purity of >90% was determined by C18 HPLC (C18 HPLC Method A, rt=8.90 min) for the isolated peptide (25 mg, as the 8 trifluoroacetic acid salt).

example 2

[0069]

(SEQ ID NO: 4)PKPEAPGKDASPEELNRYYASLRKYLNWLTRQRY-NH2

[0070]Example 2 was prepared on a 35 μmol scale as a white solid using the general method. The molecular mass of the isolated peptide was confirmed by fragment ions (M+3) / 3−1371 amu and (M+4) / 4-1028 amu, which corresponds to a peptide with the parent molecular weight of 4111 amu (ESI-MS, LC / MS Method A). A purity of >90% was determined by C18 HPLC (C18 HPLC Method A, rt=9.46 min) for the isolated peptide (20 mg, as the 8 trifluoroacetic acid salt).

example 3

[0071]

(SEQ ID NO: 5)PKPEAPGKDASPEELNRYYASLRHYLNWLTRQRY-NH2

[0072]Example 3 was prepared on a 35 μmol scale as a white solid using the general method. The molecular mass of the isolated peptide was confirmed by fragment ions (M+3) / 3−1374 amu and (M+4) / 4−1031 amu, which corresponds to a peptide with the parent molecular weight of 4120 amu (ESI-MS. LC / MS Method A). A purity of >90% was determined by C18 HPLC (C18 HPLC Method A, rt=9.42 min) for the isolated peptide (16 mg, as the 8 trifluoroacetic acid salt).

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
weight lossaaaaaaaaaa
flow rateaaaaaaaaaa
flow rateaaaaaaaaaa
Login to View More

Abstract

The present invention relates to novel analogs of PYY that have an improved therapeutic profile when compared to native human PYY. These novel PYY analogs are useful in the treatment of obesity, diabetes, and other disorders.

Description

FIELD OF THE INVENTION[0001]This invention relates to therapeutic peptides useful in the treatment of obesity and metabolic disorders. More specifically, the invention relates to novel analogs of Peptide YY (PYY) and their use.BACKGROUND OF THE INVENTION[0002]The prevalence of obesity in the United States is increasing, with 35.7% of adults considered obese (BMI≧30) and 68.8% considered overweight (BMI≧25) in 2009-2010. See, for example, Flegal et al. (2012) JAMA 307(5):491-7. Worldwide, over 300 million people are considered obese. Obesity-related diseases, including Type 2 Diabetes Mellitus, hypertension, heart disease, joint disease, and some types of cancer have increased in prevalence as the population has grown heavier.[0003]Prevention of obesity through diet and exercise is of critical importance to control these trends, but once patients become obese, the body's resistance to weight loss can be considerable. Diet and exercise alone may be insufficient to bring about signific...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): C07K14/47A61K38/17A61K38/26
CPCC07K14/47A61K38/1709A61K38/26A61K38/55C07K14/57545A61P3/04A61P43/00A61P3/10A61K2300/00A61K38/22
Inventor DOCK, STEVEN THOMASWU, YULINSRIVASTAVA, VED PHUNTER, III, ROBERT NEILCARPENTER, ANDREW JAMES
Owner GLAXOSMITHKLINE INTPROP DEV LTD
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com