Therapeutic peptides
a technology of peptides and peptides, applied in the field of therapeutic peptides, can solve problems such as weight loss of 0.6 kg
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Benefits of technology
Problems solved by technology
Method used
Image
Examples
example 1
[0067]
(SEQ ID NO: 3)PKPEAPGKDASPEELNRYYASLRHYLNWVTRQRY-NH2
[0068]Example 1 was prepared on a 35 μmol scale as a white solid using the general method. The molecular mass of the isolated peptide was confirmed by fragment ions (M+3) / 3−1369 amu and (M+4) / 4−1027 amu, which corresponds to a peptide with the parent molecular weight of 4105 amu (ESI-MS, LC / MS Method A). A purity of >90% was determined by C18 HPLC (C18 HPLC Method A, rt=8.90 min) for the isolated peptide (25 mg, as the 8 trifluoroacetic acid salt).
example 2
[0069]
(SEQ ID NO: 4)PKPEAPGKDASPEELNRYYASLRKYLNWLTRQRY-NH2
[0070]Example 2 was prepared on a 35 μmol scale as a white solid using the general method. The molecular mass of the isolated peptide was confirmed by fragment ions (M+3) / 3−1371 amu and (M+4) / 4-1028 amu, which corresponds to a peptide with the parent molecular weight of 4111 amu (ESI-MS, LC / MS Method A). A purity of >90% was determined by C18 HPLC (C18 HPLC Method A, rt=9.46 min) for the isolated peptide (20 mg, as the 8 trifluoroacetic acid salt).
example 3
[0071]
(SEQ ID NO: 5)PKPEAPGKDASPEELNRYYASLRHYLNWLTRQRY-NH2
[0072]Example 3 was prepared on a 35 μmol scale as a white solid using the general method. The molecular mass of the isolated peptide was confirmed by fragment ions (M+3) / 3−1374 amu and (M+4) / 4−1031 amu, which corresponds to a peptide with the parent molecular weight of 4120 amu (ESI-MS. LC / MS Method A). A purity of >90% was determined by C18 HPLC (C18 HPLC Method A, rt=9.42 min) for the isolated peptide (16 mg, as the 8 trifluoroacetic acid salt).
PUM
| Property | Measurement | Unit |
|---|---|---|
| weight loss | aaaaa | aaaaa |
| flow rate | aaaaa | aaaaa |
| flow rate | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 