Tumor-associated antigen XAGE-1b short peptide and application thereof

A technology of short peptides and antigen components, which can be used in tumor-specific antigens, tumor rejection antigen precursors, anti-tumor drugs, etc., and can solve the problems of unsatisfactory results and poor specificity of short peptides.

Active Publication Date: 2016-12-21
珠海美烨生物科技有限公司
View PDF7 Cites 8 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In the technical scheme disclosed by CN102428102A, an attempt is made to intercept a part of the XAGE-1b antigen to induce humoral immunity or cellular immunity to the tumor, but the result is not satisfactory, and the length of the polypeptide is still not shorter than 16AA
[0013] Short peptides may also have the problem of poor specificity. How to obtain short peptides with good specificity and good immunogenicity is a very challenging task

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Tumor-associated antigen XAGE-1b short peptide and application thereof
  • Tumor-associated antigen XAGE-1b short peptide and application thereof
  • Tumor-associated antigen XAGE-1b short peptide and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0027] The tumor antigen is XAGE-1b antigen. The XAGE-1b gene is located on the X chromosome (Xp11.21-Xp11.22), with a full length of 622bp, encoding a protein precursor composed of 81 amino acids. The amino acid sequence is as follows (from GenBank: NM_001097594.2):

[0028]MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV (SEQ ID NO: 1)

[0029] The technical solution of the present invention will be further described below in combination with experiments.

[0030] Expression of XAGE-1b in non-small cell lung cancer

[0031] XAGE-1 is an important member of the CTA family. In addition to being widely expressed in non-small cell lung cancer, it is also expressed in a variety of malignant tumors. It is extremely important to establish XAGE-1b antigen peptide-specific CTL clones. In the previous study, the inventors randomly selected surgically resected lung cancer specimens (all confirmed by pathological examination and obtained the consent of...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses a tumor-associated antigen XAGE-1b short peptide and an application thereof. The sequence of the short peptide is selected from SEQ ID NO: 2-SEQ ID NO: 13. Cytotoxic T lymphocytes (CTLs) induced by the XAGE-1b antigen peptides do not generate immune response to testicular cells, and only kill tumor cell. The induced CTL clones have good tumor cell specific killing effect. Meanwhile, in the process of establishing the CTLs, the screened XAGE-1b antigen peptides are found to have appropriate affinity with HLA on DC cells and can effectively stimulate and induce the generation of specific CTLs, and it is proved that the XAGE-1b antigen peptides have good potential of a polypeptide vaccine and a DC vaccine. XAGE-1 b antigen peptide specific TCR genes are cloned, a virus carrier is constructed, the genes are transduced to CD8+T cells from peripheral circulation to obtain TCR gene modified T cell (TCR-T) clones, and also the specific killing effect on tumor cells similar to parental CTLs is obtained, and thus the tumor-associated antigen XAGE-1b short peptide has good clinical conversion and practical application prospect.

Description

technical field [0001] The invention relates to tumor-associated antigen peptides and applications thereof, in particular to tumor-associated antigen XAGE-1b short peptides and applications thereof. Background technique [0002] As we all know, T cell adoptive therapy for tumors is currently the most eye-catching technology, especially the application of receptor-engineered T cells is becoming an exciting cancer treatment method, and it also has broad application prospects for viral infections and autoimmune diseases. [0003] The human immune surveillance system plays an important role in the process of resisting tumor growth. The immune surveillance system achieves the purpose of inhibiting tumor growth by coordinating various types of immune cells, among which cytotoxic T cells (cytotoxic Tlymphocytes, CTLs) play an extremely important role and are the most important. Key killer effector cells. tumor antigen-specific CD8 + T cells can specifically recognize and directly...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/47C12N5/0783A61K39/00A61P35/00G01N33/68G01N33/574
CPCA61K39/0011A61K2039/5154A61K2039/572C07K14/4748C12N5/0638C12N2501/998C12N2502/1121G01N33/57423G01N33/68G01N2333/47
Inventor 安军
Owner 珠海美烨生物科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products