Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Application of a cecropin-derived peptide

A technology for deriving peptides and cecropin, which is applied in the field of biomedicine, can solve the problems of high production cost, exacerbation of sepsis, and high synthesis cost, and achieve the effect of reducing synthesis cost and good application prospects

Active Publication Date: 2022-02-22
SUZHOU UNIV
View PDF3 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, antimicrobial peptides have not been widely used, and one of the important limiting factors is the relatively high cost of synthesis
[0006] In short, the treatment of drug-resistant bacteria infection is still mainly based on antibiotic treatment clinically, and the combined treatment of multiple antibiotics will not only accelerate the process of drug-resistant bacteria, but also cause a large number of bacteria to be killed and release a large amount of bacteria. Endotoxin, exacerbating the occurrence of complications such as sepsis
Antimicrobial peptides have certain advantages in the treatment of drug-resistant bacterial infections, but their wide-scale promotion and application are limited due to high production costs

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of a cecropin-derived peptide
  • Application of a cecropin-derived peptide
  • Application of a cecropin-derived peptide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0028] Example 1: RL23 sequence and its preparation

[0029] In order to reduce the cecropin N derived from Aedes aegypti (GeneBank accession number: AHH41648.1, the amino acid sequence of the mature peptide is RWKFGKKLEKVGKNVFNAAKKALPVVAGYKAL-NH 2 , composed of 32 amino acids, with a molecular weight of 3560.34 Daltons and an isoelectric point of 10.54. It is a straight chain peptide, all amino acids are L-type, and its C-terminus is amidated) in the production cost of application in resistance to drug-resistant bacterial infections , with cecropin N as a template, intercept the N-terminal α-helical domain of the mature peptide, named RL23, and its amino acid sequence is RWKFGKKLEKVGKNVFNAAKKAL-NH 2 (SEQ ID No.1), composed of 23 amino acids, with a molecular weight of 2661.24 Daltons and an isoelectric point of 10.75, is a linear peptide, all amino acids are L-type, and its C-terminus is amidated.

[0030] When synthesizing the RL23 sequence, the entire sequence can be synth...

Embodiment 2

[0031] Embodiment 2: RL23 and cecropin N test and compare the minimum inhibitory concentration of Acinetobacter baumannii

[0032] Add 100 μL LB broth medium to the 96-well culture plate in advance; then add 100 μL diluted polypeptide (cecropin N or RL23) sample to the first well, mix well and add 100 μL to the second well, and perform a series of Two-fold serial dilution; dilute the Acinetobacter baumannii solution to 2×10 5 CFU / mL, then add 100 μL of the diluted bacterial solution to the 96-well culture plate where the peptide sample has been added; shake and mix gently, put the 96-well culture plate at 37°C for 16 hours, and then measure it with a microplate reader Light absorption value at 600nm.

[0033]The results are shown in Table 1. Both the parent peptide cecropin N and its derivative peptide RL23 can effectively inhibit the growth of Acinetobacter baumannii. The minimum inhibitory concentrations of Acinetobacter baumannii were 4.68μg / mL (1.31μM) and 2.34μg / mL (0.6...

Embodiment 3

[0036] Embodiment 3: Acinetobacter baumannii is tested for antibiotic susceptibility

[0037] According to the method of Example 1, the sensitivity of the selected Acinetobacter baumannii strains in Example 1 to antibiotics commonly used in the clinical treatment of its infection was determined. Taking penicillin and gentamicin as representatives, detect the minimum inhibitory concentration concentrations of penicillin and gentamicin to the strains selected in Example 1.

[0038] The results are shown in Table 2, the minimum inhibitory concentration of gentamicin to Acinetobacter baumannii ATCC19606 is 8 μg / mL, but the minimum inhibitory concentration of penicillin to Acinetobacter baumannii ATCC19606 The bacterial concentration was higher than 256 μg / mL. It is worth noting that clinical isolates of Acinetobacter baumannii showed a high degree of resistance to gentamicin and penicillin at concentrations as high as 256 μg / mL. There was no inhibitory effect on the growth of th...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
concentrationaaaaaaaaaa
molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention discloses the application of a cecropin-derived peptide in the preparation of anti-Acinetobacter baumannii infection medicine, wherein the amino acid sequence of the cecropin-derived peptide is shown in SEQ ID No.1. The present invention also provides a bacteriostatic drug, including the cecropin-derived peptide shown in SEQ ID No.1, and the bacteriostatic drug is used for inhibiting Acinetobacter baumannii. The present invention also provides an anti-inflammatory drug, including the cecropin-derived peptide shown in SEQ ID No.1, and the inflammation is induced by Acinetobacter baumannii infection. The cecropin-derived peptide of the invention can be used to prepare drugs for resisting Acinetobacter baumannii infection, has small molecular weight, low production cost, and also has resistance to drug-resistant bacteria.

Description

technical field [0001] The invention relates to the application of a cecropin-derived peptide in the preparation of anti-acinetobacter baumannii infection medicine, which belongs to the technical field of biomedicine. Background technique [0002] Acinetobacter baumannii (Acinetobacter baumannii) is a Gram-negative bacillus that widely exists in nature, such as soil and water sources. In addition, it is distributed in human skin, digestive tract, respiratory tract and genitourinary tract and can survive for a long time . Acinetobacter baumannii is an opportunistic pathogen with strong adhesion and transmission ability, and it is difficult to eliminate it by general physical or chemical methods such as ultraviolet light, high temperature, and chemical disinfectants. Once immunocompromised people, such as newborns, old people, patients, etc., are easily infected and induce serious complications through air or direct contact with people or objects carrying Acinetobacter bauman...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): A61K38/17A61P31/04A61P29/00C07K14/435
CPCA61K38/1767A61P29/00A61P31/04C07K14/43577
Inventor 卫林何小芹武静徐薇
Owner SUZHOU UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com