Porcine circovirus type 2 cap gene modification and recombinant antigen and its application
A technology of porcine circovirus and porcine circovirus disease, which is applied in the direction of virus antigen components, plant gene improvement, viruses, etc., can solve the problems of high price, unsatisfactory immune protection effect, and high-titer virus difficulty, and achieve High antibody level, good application prospect, easy storage and application effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0032] Example 1 Preparation of porcine circovirus type 2 modified recombinant antigen
[0033] 1. Screening of a gene with significant immune enhancement effect:
[0034] Porcine circovirus type 2 Cap protein is the main structural protein of the virus, which constitutes the nucleocapsid of the virus, and the encoded protein can bind to the host cell receptor. It is the main immunogenic protein of the virus and can stimulate the body to produce antibodies , significantly reducing the incidence of immunized pigs, but in practical applications, both prokaryotic expression and eukaryotic expression of Cap protein have defects such as high cost, limited expression yield, high requirements for protein purification, and poor immunogenicity. In order to improve the immunogenicity of Cap protein, this study used DNAStar biological software to analyze a gene with significant immune enhancement effect, and use this gene to modify the Cap gene in order to achieve the purpose of enhancin...
Embodiment 2
[0039] Example 2 Preparation of Porcine Circovirus Type 2 Cap Gene Modified Subunit Vaccine and Its Immunological Efficacy Analysis
[0040] 1. Vaccine preparation:
[0041] The endotoxin-removed protein (amino acid sequence shown in SEQ ID NO: 2 and SEQ ID NO: 4, respectively) was quantified by the BCA protein quantitative analysis kit and diluted to an appropriate concentration, and the modified protein was added with an equal volume of Freund's adjuvant (Sigma) into vaccine formulations.
[0042] The amino acid sequence of the porcine circovirus type 2 LG strain Cap protein after removal of the nuclear localization signal is shown in SEQ ID NO:4.
[0043] Said SEQ ID NO: 4 is as follows:
[0044] NGIFNTRLSCTFGYTVKATTVRTPSWAVDMMRFNINDFVPPGGGTNEISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTRATALTYGPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTSANVDHVGLGIAFENSTYDQDYNIRVTMYKDPLKEFPL.
[0045] The nucleotide sequence of the porcine circovirus type 2 LG strain Cap protein aft...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 



