A kind of polypeptide hip-20 that can antagonize the RNA binding activity of hnrnpu protein and its application
A technology that combines activity and protein, and is applied to polypeptides, hybrid peptides, and peptide/protein components containing localization/targeting motifs.
- Summary
- Abstract
- Description
- Claims
- Application Information
 AI Technical Summary 
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0025] The principles and features of the present invention are described below in conjunction with examples, which are only used to explain the present invention and are not intended to limit the scope of the present invention.
[0026] 1. Synthesis of Antitumor Peptides
[0027] Synthesize an anti-tumor polypeptide by solid-phase synthesis, which includes a tumor cell killing domain and a membrane-penetrating domain, wherein the tumor cell killing domain sequence is shown in SEQ ID NO: 1, and the membrane-penetrating domain sequence is as shown in SEQ ID NO: 1 As shown in ID NO: 2, it is connected to the N-terminal of the tumor cell killing domain, and the obtained sequence is: the amino acid sequence is YGRKKRRQRRR-NMRGGNFRGGAPGNRGGYNK (SEQ ID NO: 3), named HIP-20. For the convenience of research, we linked FITC to the C-terminus of the anti-tumor polypeptide.
[0028] The synthesis is carried out from the C-terminal to the N-terminal, and the steps are as follows:
[002...
PUM
 Login to View More
 Login to View More Abstract
Description
Claims
Application Information
 Login to View More
 Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



