Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A kind of polypeptide hip-20 that can antagonize the RNA binding activity of hnrnpu protein and its application

A technology that combines activity and protein, and is applied to polypeptides, hybrid peptides, and peptide/protein components containing localization/targeting motifs.

Active Publication Date: 2020-03-27
XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Although there have been many reports of new anti-tumor polypeptides, some of which have entered clinical trials, there is no report on anti-tumor polypeptides targeting hnRNPU protein

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of polypeptide hip-20 that can antagonize the RNA binding activity of hnrnpu protein and its application
  • A kind of polypeptide hip-20 that can antagonize the RNA binding activity of hnrnpu protein and its application
  • A kind of polypeptide hip-20 that can antagonize the RNA binding activity of hnrnpu protein and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0025] The principles and features of the present invention are described below in conjunction with examples, which are only used to explain the present invention and are not intended to limit the scope of the present invention.

[0026] 1. Synthesis of Antitumor Peptides

[0027] Synthesize an anti-tumor polypeptide by solid-phase synthesis, which includes a tumor cell killing domain and a membrane-penetrating domain, wherein the tumor cell killing domain sequence is shown in SEQ ID NO: 1, and the membrane-penetrating domain sequence is as shown in SEQ ID NO: 1 As shown in ID NO: 2, it is connected to the N-terminal of the tumor cell killing domain, and the obtained sequence is: the amino acid sequence is YGRKKRRQRRR-NMRGGNFRGGAPGNRGGYNK (SEQ ID NO: 3), named HIP-20. For the convenience of research, we linked FITC to the C-terminus of the anti-tumor polypeptide.

[0028] The synthesis is carried out from the C-terminal to the N-terminal, and the steps are as follows:

[002...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention provides a polypeptide that can antagonize the RNA binding activity of hnRNPU protein and its application, and its amino acid sequence is shown in SEQ ID NO: 1; it also relates to an anti-tumor polypeptide and its application, and the anti-tumor polypeptide includes tumor cells The killing domain and the membrane-penetrating domain, the amino acid sequence of the tumor cell killing domain is shown in SEQ ID NO:1. The transmembrane domain of the anti-tumor polypeptide of the present invention has no cytotoxicity itself, but after linking with the tumor cell killing domain, it has obvious effects of inhibiting tumor proliferation, migration and invasion. The anti-tumor polypeptide of the present invention can not only be used as an anti-tumor biotherapeutic drug alone, but is also expected to be combined with other treatment methods to inhibit tumors.

Description

technical field [0001] The invention relates to the field of tumor targeting therapy, and more particularly relates to a polypeptide capable of antagonizing the RNA binding activity of hnRNPU protein and its application. Background technique [0002] As we all know, tumor is a worldwide medical problem, which brings great harm to human health. Conventional tumor therapy drugs are often poor in tissue specificity, causing damage to normal tissues while killing tumors, causing great side effects and bringing great pain to tumor patients. Therefore, the development of tumor-targeting peptide drugs with high specificity and significant curative effect has aroused great interest. [0003] Tumor-targeting polypeptide refers to a class of active polypeptides that can target specific molecules related to tumor occurrence and development. It is currently considered the most ideal tumor-targeting therapy. Compared with traditional chemotherapy drugs, tumor-targeting peptides have th...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K7/08C07K19/00A61K38/10A61K47/64A61P35/00
CPCA61K38/00C07K7/08C07K2319/10
Inventor 童强松郑丽端宋华杰杨枫方二虎王晓静叶霖李聃
Owner XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com