Anti-cd47/cd20 bispecific antibody and use thereof
A bifunctional antibody and antibody technology, applied in the field of tumor immunology
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0200] Example 1 Molecular Sequence Design of Anti-CD47 / CD20 Bispecific Antibody
[0201] The structure of the bispecific antibody that can simultaneously bind to the extracellular domains of CD47 and CD20 provided by the present invention is as follows: figure 1 shown. The CD47 nanobody sequence is derived from patent 201810151752.6; then the above CD47 nanobody is fused with the heavy chain of rituximab, and the heavy chain is produced by Linker ((GGGGS) 4 ) to link the rituximab heavy chain (LALA) and the CD47 Nanobody, the amino acid sequence is as follows (the underlined part is the Linker sequence):
[0202] A: The amino acid sequence is shown in SEQ ID NO.: 14, and the CD47 Nanobody is connected to the N-terminal of the heavy chain of the rituximab through a linker (GGGGS) 4;
[0203] QVQLQESGGGLVQPGGSLRLSCAASGYAYTSDCMGWFRQTPGKGLEGVALIYTPGNSTNYADSVKGRFTISQDNSKSTVYLQMNSLRAEDTAMYYCAARRGACSLRLPFFYWGQGTLVTVSS GGGGSGGGGSGGGGSGGGGS QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQT...
Embodiment 2
[0214] Example 2 Expression and purification of anti-CD47 / CD20 bispecific antibody
[0215] Transiently transfer the two plasmids containing the synthetic gene into HEK293F cells. The specific method is as follows: (1) Use the OMEGA plasmid answering kit to prepare a large number of plasmids containing the heavy chain and the plasmid containing the light chain respectively. Filter and sterilize in the stage for standby; (2) Cultivate HEK293F cells to 2.0×10 6 each / mL; (3) Mix the heavy chain plasmid and the light chain plasmid according to the mass ratio of 2:3, and mix the mixed plasmid with the transfection reagent PEI at a ratio of 1:3 to the transfection medium F17 (Gibco) Stand in the middle for 20min, then add to HEK293F cells, at 37℃, 6%CO 2 Cultivate in a shaker incubator for 6 days; (4) Centrifuge to obtain the supernatant, combine the supernatant with protein A beads at room temperature for 1 hour; (5) Use pH 7.0 phosphate buffer to wash away foreign proteins and ot...
Embodiment 3
[0218] Embodiment 3 FACS detects the binding situation of antibody and cell surface antigen
[0219] Binding of anti-CD47 / CD20 bispecific antibody (A-F) to CD20 on cell surface: (1) 3×10 5 Raji (CD20+) cells (each sample) were incubated with 100uL of CD47 nanobody Nb1902 (expressed in E.coli) at a concentration of 80ug / mL for 20min at 4°C; (2) Antibody dilution: each group of antibodies were serially diluted ( 100ug / mL, 50ug / mL, 25ug / mL, 12.5ug / mL, 6.25ug / mL, 3.125ug / mL, 1.56ug / mL, 0.78ug / mL, 0.39ug / mL, 0.195ug / mL, 0.0976ug / mL mL, 0.0488ug / mL), incubate 100uL of the diluted antibody with each well of Raji cells for 20min at 4°C, and set a positive control (rituximab) at the same time; (2) Wash the cells twice with PBS, add eBioscience’s Anti-hFc-FITC (diluted at 1:200) was incubated at 4°C for 20 min, cells were washed twice with PBS and detected by flow cytometry (BD FACS Calibur), and data processing was performed using graphpad prism 6 software. The result is as figure ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


