Polypeptide fragment composition and application in preparation of porcine reproductive and respiratory syndrome vaccine thereof
A technology for respiratory syndrome and polypeptide fragments, which is applied in the field of preparation of porcine reproductive and respiratory syndrome vaccines, can solve the problems of difficult control and eradication of PRRSV, strong virulence, and is not suitable for piglet immunization, and achieves easy large-scale synthesis, The effect of coping with antigenic variation and good application prospects
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0034] Embodiment 1, the synthesis of polypeptide fragment and APP-N protein
[0035] 1. Synthesis of polypeptide fragments
[0036] Design six polypeptide fragments (all T cell epitopes), the sequence is as follows (from nitrogen terminal to carbon terminal):
[0037] Polypeptide I (sequence 1 of the sequence listing): TMPPGFELYGGGGSGGGGSFLLVGFKCF;
[0038] Polypeptide II (sequence 2 of the sequence listing): CLLPSLLAIGGGGSGGGGSLAALICFVIRLAKNC;
[0039] Polypeptide III (sequence 3 of the sequence listing): KGRLYRWRSPVIVEKGGGGSGGGGSCNDSTAPQKVLLAFS;
[0040] Polypeptide IV (sequence 4 of the sequence listing): ALKVSRGRLLGLLHLGGGGSGGGGSFGYMTFVHFESTNRV;
[0041] Polypeptide V (sequence 5 of the sequence listing): KFITSRCRLCLLGRKGGGGSGGGGSNPEKPHFPL;
[0042]Polypeptide VI (sequence 6 of the sequence listing): VRHHFPSEGGGGSGGGGSFSLPTQHTVRLIRATAS;
[0043] The above six polypeptides were chemically synthesized respectively.
[0044] 2. Synthesis of APP-N protein
[0045] APP-...
Embodiment 2
[0057] Embodiment 2, the preparation of vaccine
[0058] 1. Preparation of Vaccine A
[0059] 1. Dilute the polypeptide I, polypeptide II, polypeptide III, polypeptide IV, polypeptide V and polypeptide VI prepared in Example 1 to 1.2 mg / ml with water for injection (sterile water), and then mix them in equal volumes to make an aqueous phase Antigen (the concentration of the 6 polypeptide fragments in the aqueous phase antigen is 0.2mg / ml).
[0060] 2. Dilute the APP-N protein (adjuvant) prepared in Example 1 with water for injection (sterile water) to a protein concentration of 0.2 mg / ml, which is the aqueous phase of the protein adjuvant.
[0061] 3. Under the condition of 6°C (4-8°C is acceptable), mix the water-phase antigen in step 1 and the protein adjuvant in step 2 in equal volumes, and mix and combine at a slow speed of 50 rpm on a mixer After 2 hours, the aqueous phase adjuvant-antigen immunogen (the concentration of APP-N protein is 100μg / ml, the concentration of po...
Embodiment 3
[0071] Embodiment 3, efficacy experiment of vaccine
[0072] 1. Experimental animals
[0073] Fifty 6-week-old healthy pigs (Landrace pigs, purchased from Changping Animal Experiment Base, Beijing Institute of Animal Husbandry and Veterinary Medicine, Chinese Academy of Agricultural Sciences) were double-negative for PRRSV antigen and antibody.
[0074] Second, the application of vaccines to immunize animals
[0075] The experimental animals were randomly divided into 5 groups, 10 in each group, and the following immunizations were carried out respectively:
[0076] Group 1 (experimental group A): the vaccine A prepared in Example 2 was used for immunization;
[0077] Group 2 (experimental group B): the vaccine B prepared in Example 2 was used for immunization;
[0078] The 3rd group (negative control group): adopt the reference substance A prepared in embodiment 2 to carry out immunization;
[0079] The 4th group (blank control group): adopt the reference substance B prep...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 