Pharmaceutical composition for preventing or treating cancer metastasis to lung, containing chi3l1 inhibitor as active ingredient

A composition and drug technology, applied in the directions of medical preparations containing active ingredients, drug combinations, organic active ingredients, etc., to achieve fast and efficient treatment or prevention effects, and the effects of preventing and inhibiting lung metastases

Pending Publication Date: 2020-08-11
IUCF HYU (IND UNIV COOP FOUND HANYANG UNIV)
View PDF2 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0005] Some genes have been found to regulate multiple stages of this metastasis, but because cancer metastasis is a very complex process caused by multiple inherited or acquired genetic mutations, in practice, an increase in the expression level of a specific gene or The reduction does not directly result in

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Pharmaceutical composition for preventing or treating cancer metastasis to lung, containing chi3l1 inhibitor as active ingredient
  • Pharmaceutical composition for preventing or treating cancer metastasis to lung, containing chi3l1 inhibitor as active ingredient
  • Pharmaceutical composition for preventing or treating cancer metastasis to lung, containing chi3l1 inhibitor as active ingredient

Examples

Experimental program
Comparison scheme
Effect test

Embodiment approach

[0146] Hereinafter, the present invention will be described in more detail through examples and the like, but the content and scope of the present invention should not be interpreted by narrowing or limiting the content and scope of the present invention through the following examples and the like. Moreover, based on the disclosure of the present invention including the following embodiments, it is obvious that those skilled in the art can easily implement the present invention without specific experimental results, and such variations and modifications naturally belong to the scope of the appended claims.

[0147]

[0148] 1) Animal model

[0149] C57BL / 6J mice aged 6-8 weeks were used. Chi3l1 KO mice used were provided by Jack A Elias (Brown University). All mice were reared and kept in a specific aseptic facility (Hanyang University), maintaining the facility conditions of 21±1°C temperature, 50±5% humidity and 12-hour cycle of day and night (regular chow, PicoLab Rode...

manufacture example 1

[0180] Synthesis of dNP2-HA2 peptide and Chi3l1 siRNA

[0181] A dNP2-HA2 peptide having the Chi3l1 siRNA sequence of SEQ ID NO: 1 and the amino acid sequence of SEQ ID NO: 2 was synthesized.

[0182] Here, the siRNA of Chi3l1 represented by the sequence of SEQ ID NO: 1 (hereinafter also referred to as 'siChi3l1') and the cell-permeable peptide (hereinafter also referred to as 'dNP2') composed of the amino acid sequence of SEQ ID NO: 2 were used to perform marked.

[0183] After designing each sequence, the Chi3l1 siRNA represented by the sequence No. 1 used was synthesized and manufactured by entrusting Bioneer, and the dNP2-HA2 peptide represented by the sequence No. 2 was synthesized and manufactured by entrusting Genscript of.

[0184] serial number 1

[0185] CAGGAGUUUAAUCUCUUGCAA

[0186] serial number 2.

[0187] KIKKVKKKGRKGSKIKKVKKKGRKGLFGAIAGFIENGWEGMIDG

Embodiment 1

[0188] Production of dNP2-siChi3l1 complex.

[0189] In order to fuse the dNP2-HA peptide having the amino acid sequence of siChi3l1 of SEQ ID NO: 1 and SEQ ID NO: 2 produced in Production Example 1, 2ug of siChi3l1 was reacted with 70ug of dNP2-HA2 peptide for 30 minutes at room temperature and in the dark. .

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention relates to a pharmaceutical composition enabling the prevention or treatment of cancer metastasis to the lung and, more specifically, to a composition which enhances the immunityof the lung against cancer rather than inducing apoptosis of existing cancer, thereby enabling effective inhibition, prevention or treatment of cancer metastasis to the lung after the cancer occurs.

Description

technical field [0001] The present invention relates to a pharmaceutical composition capable of preventing or treating lung metastases of cancer. More specifically, it does not induce and kill the cancer that has occurred, but can effectively inhibit, prevent or treat cancer after cancer occurs by strengthening the immunity of the lung to cancer. Compositions for the treatment of lung metastases of cancer. Background technique [0002] Among the major diseases of modern people, cancer remains incurable despite decades of human efforts. Cancer, the biggest disease that threatens human health, is a disease in which cells proliferate and die in an unlimited and unregulated manner through a process of mutation. Through various research and development, related mechanisms and multiple methods based on this have been developed. A therapeutic agent, but there is no fundamental cure yet. [0003] The vast majority of cancer deaths are due to cancer metastasis, especially recurrenc...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): A61K48/00A61K38/16A61K9/00A61P35/04
CPCA61K48/00A61P35/04A61K31/7088A61K9/0073A61K9/0043C12N15/1138C12N2310/14C12N2320/32C12N2310/3513A61K38/16A61K9/007C12N15/1135C12N15/1136C12N15/63C12N15/86C12N15/861C12N15/8645
Inventor崔济民金度炫
OwnerIUCF HYU (IND UNIV COOP FOUND HANYANG UNIV)