Vaccine preparation for cancer treatment

A cancer treatment and vaccine technology, which can be applied to vaccines, medical preparations without active ingredients, and medical preparations containing active ingredients, etc., and can solve many problems such as unclear conditions.

Inactive Publication Date: 2014-07-30
MIE UNIVERSITY
View PDF5 Cites 6 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, for hydrophobized polysaccharides used as vaccine antigen delivery systems, such conditions are not yet clear

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Vaccine preparation for cancer treatment
  • Vaccine preparation for cancer treatment
  • Vaccine preparation for cancer treatment

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0078] Next, embodiments of the present invention will be described with reference to the drawings, but the technical scope of the present invention is not limited by these embodiments, and can be implemented in various forms without changing the gist of the invention. In addition, the technical scope of the present invention extends to an equal range.

[0079]

[0080] (1) Material

[0081] BALB / c mice (female, 5 weeks old) were purchased from SLC, Japan, and bred at the Animal Center, Faculty of Medicine, Mie University. It was used for experiments after acclimatization for 1 week. The experimental plan regarding the use of mice was approved by the Ethics Committee of Mie University Faculty of Medicine. Synthetic long peptides were purchased from GenScript, Scrum or Biologica. The sequence of the synthetic long peptide is as follows: MAGE-A4p264:40 (amino acid sequence (SEQ ID: 1)): GSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP, including 9 amino acids from S at position 2 t...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
particle diameteraaaaaaaaaa
particle diameteraaaaaaaaaa
Login to View More

Abstract

An object of the invention is to provide a method of clearly deriving killer T cells and helper T cells in a cancer treatment vaccine in which the vaccine antibody is a synthetic long peptide which is derived from a tumor-specific antigen protein and / or pathogen-derived protein and which simultaneously contains a CD8-positive, cytotoxic T-cell recognizing epitope and a CD4-positive, helper T-cell recognizing epitope peptide. By simultaneously dosing an immunopotentiating agent with a conjugate of a hydrophobized polysaccharide (the antigen delivery system) to the synthetic long peptide, it is possible to achieve clear derivation of antigen-specific killer T-cells and helper T-cells from the cancer treatment vaccine in which the synthetic long peptide is the antigen.

Description

technical field [0001] The present invention relates to a method for treating cancer, and in particular to a vaccine for treating cancer. More specifically, it relates to a vaccine preparation for cancer therapy comprising a synthetic long peptide as a vaccine antigen, a hydrophobized polysaccharide as an antigen delivery system, and an immunopotentiator that stimulates antigen-presenting cells. Background technique [0002] The results of many years of research on the immune response to cancer have clarified the importance of cellular immunity in tumor rejection in cancer hosts. In particular, it is clear that CD8-positive cytotoxic T cells (hereinafter referred to as killer T cells) are effector cells that can directly destroy tumors, and CD4-positive helper T cells (hereinafter referred to as helper T cells) are enhanced killer T cells and antigens. An important regulatory cell of presenting cell function, and antigen presenting cells centered on dendritic cells stimulat...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): A61K39/00A61K39/12A61K45/00A61K47/36A61K47/48A61P31/12A61P35/00C07K14/00C07K19/00C12N15/117
CPCC07K14/4748A61K39/0011C12N15/117A61K2039/55511A61K2039/6087C12N2310/17A61K45/06A61K2039/55561C07K2319/00C07K2319/40A61K47/61A61P31/12A61P35/00A61K39/001157A61K39/001188A61K39/00115A61K39/001106A61K39/001153A61K39/001186A61K2039/80A61K2300/00A61K39/385
Inventor珠玖洋原田直纯村冈大辅秋吉一成
OwnerMIE UNIVERSITY