Unlock instant, AI-driven research and patent intelligence for your innovation.

Polypeptide of targeted tumor cell and application thereof

A technology for tumor cells and tumor cell proliferation, applied to polypeptides that promote tumor cell proliferation and/or migration and its application fields, can solve problems such as tissue damage and pain of tumor patients, and achieve the effect of changing tumor proliferation

Active Publication Date: 2017-08-08
XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
View PDF3 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

With the advancement of medical technology and basic research, the treatment of various tumors has been significantly improved, but conventional tumor treatment methods (including surgery, chemotherapy, radiotherapy and immunotherapy) have caused damage to the normal tissues of the body and caused great harm. Side effects, causing great pain to cancer patients

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polypeptide of targeted tumor cell and application thereof
  • Polypeptide of targeted tumor cell and application thereof
  • Polypeptide of targeted tumor cell and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0020] The principles and features of the present invention are described below in conjunction with examples, which are only used to explain the present invention and are not intended to limit the scope of the present invention.

[0021] 1. Synthesis of polypeptides that promote tumor cell proliferation

[0022] A polypeptide that promotes tumor cell proliferation is synthesized by solid-phase synthesis, which includes a tumor cell targeting domain and a membrane-penetrating domain, wherein the tumor cell targeting domain sequence is shown in SEQ ID NO: 1, membrane-penetrating The structural domain sequence is shown in SEQ ID NO: 2, which is connected to the N-terminal of the tumor cell targeting domain. The obtained sequence is: the amino acid sequence is YGRKKRRQRRR-MNRSTTRSAPCRPMLGVYYRYKNSLWSII (SEQ ID NO: 3). For the convenience of research, we also labeled FITC with fluorescein isothiocyanate at the C-terminus of the anti-tumor polypeptide. The synthesis is outsourced by...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a polypeptide of a targeted tumor cell and application thereof. An amino acid sequence is shown in SEQ ID NO:1. The invention also relates to a polypeptide for accelerating tumor cell proliferation and / or migration and the application thereof. The polypeptide has the advantages that the transmembrane structural domain of the polypeptide does not have cytotoxicity, and the polypeptide has an obvious effect of changing tumor proliferation and migrating invasion behavior after being connected with a tumor cell targeted structural domain. The polypeptide disclosed by the invention can become an active polypeptide for screening targeted biological therapy tumors.

Description

technical field [0001] The present invention relates to the field of tumor targeting therapy, more particularly, relates to a polypeptide targeting tumor cells and its application, and also relates to a polypeptide promoting tumor cell proliferation and / or migration and its application. Background technique [0002] Tumor is a major disease that seriously threatens human life and has become the main cause of human death. With the advancement of medical technology and basic research, the treatment of various tumors has been significantly improved, but conventional tumor treatment methods (including surgery, chemotherapy, radiotherapy and immunotherapy) have caused damage to the normal tissues of the body and caused great harm. Side effects bring great pain to cancer patients. [0003] Targeted tumor therapy refers to the targeted treatment of tumors by interfering with the key targets that regulate the occurrence and development of tumors. Compared with traditional radiothe...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/00C12Q1/02
CPCC07K14/001G01N33/5017
Inventor 郑丽端童强松宋华杰方二虎王晓静叶霖李聃杨枫
Owner XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV