Polypeptide of targeted tumor cell and application thereof
A technology for tumor cells and tumor cell proliferation, applied to polypeptides that promote tumor cell proliferation and/or migration and its application fields, can solve problems such as tissue damage and pain of tumor patients, and achieve the effect of changing tumor proliferation
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0020] The principles and features of the present invention are described below in conjunction with examples, which are only used to explain the present invention and are not intended to limit the scope of the present invention.
[0021] 1. Synthesis of polypeptides that promote tumor cell proliferation
[0022] A polypeptide that promotes tumor cell proliferation is synthesized by solid-phase synthesis, which includes a tumor cell targeting domain and a membrane-penetrating domain, wherein the tumor cell targeting domain sequence is shown in SEQ ID NO: 1, membrane-penetrating The structural domain sequence is shown in SEQ ID NO: 2, which is connected to the N-terminal of the tumor cell targeting domain. The obtained sequence is: the amino acid sequence is YGRKKRRQRRR-MNRSTTRSAPCRPMLGVYYRYKNSLWSII (SEQ ID NO: 3). For the convenience of research, we also labeled FITC with fluorescein isothiocyanate at the C-terminus of the anti-tumor polypeptide. The synthesis is outsourced by...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


